BLASTX nr result
ID: Zingiber23_contig00041330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00041330 (353 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526683.1| Systemin receptor SR160 precursor, putative ... 79 8e-13 gb|EMJ21801.1| hypothetical protein PRUPE_ppa001349mg [Prunus pe... 77 2e-12 gb|ESW13720.1| hypothetical protein PHAVU_008G220100g [Phaseolus... 77 2e-12 ref|XP_003516400.1| PREDICTED: probably inactive leucine-rich re... 77 3e-12 ref|XP_003545217.2| PREDICTED: probably inactive leucine-rich re... 76 5e-12 ref|XP_006481114.1| PREDICTED: probably inactive leucine-rich re... 75 7e-12 ref|XP_006429492.1| hypothetical protein CICLE_v10011081mg [Citr... 75 7e-12 ref|XP_004506813.1| PREDICTED: probably inactive leucine-rich re... 75 7e-12 ref|XP_004308965.1| PREDICTED: probable leucine-rich repeat rece... 75 7e-12 ref|XP_004305103.1| PREDICTED: probably inactive leucine-rich re... 75 7e-12 ref|XP_004166117.1| PREDICTED: LOW QUALITY PROTEIN: probable leu... 75 7e-12 ref|XP_004146459.1| PREDICTED: probably inactive leucine-rich re... 75 7e-12 ref|XP_003522034.1| PREDICTED: probably inactive leucine-rich re... 75 7e-12 ref|XP_003604522.1| Receptor-like kinase [Medicago truncatula] g... 75 7e-12 ref|XP_002323617.2| LRR-kinase family protein [Populus trichocar... 75 9e-12 ref|XP_004240887.1| PREDICTED: probably inactive leucine-rich re... 75 9e-12 ref|XP_003604527.1| Receptor-like kinase RHG1 [Medicago truncatu... 75 9e-12 gb|ESW06636.1| hypothetical protein PHAVU_010G064300g [Phaseolus... 75 1e-11 gb|EOY07065.1| Inflorescence meristem receptor-like kinase 2 iso... 75 1e-11 ref|XP_002264565.1| PREDICTED: probably inactive leucine-rich re... 74 2e-11 >ref|XP_002526683.1| Systemin receptor SR160 precursor, putative [Ricinus communis] gi|223533983|gb|EEF35705.1| Systemin receptor SR160 precursor, putative [Ricinus communis] Length = 811 Score = 78.6 bits (192), Expect = 8e-13 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAEPEAPKAD 195 GDELLNTLKLALHCVDPSP+ARPE QQV+QQLEEI P+LA S E P ++ Sbjct: 759 GDELLNTLKLALHCVDPSPSARPEVQQVVQQLEEIKPDLAASSADEGTKPTSE 811 >gb|EMJ21801.1| hypothetical protein PRUPE_ppa001349mg [Prunus persica] Length = 848 Score = 77.4 bits (189), Expect = 2e-12 Identities = 40/55 (72%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAE-PEAPKADE 192 GDELLNTLKLALHCVDPSP+ARPE QQV+QQLEEI PE A S + AP A E Sbjct: 794 GDELLNTLKLALHCVDPSPSARPEVQQVLQQLEEIRPETAASSSDDGAGAPSASE 848 >gb|ESW13720.1| hypothetical protein PHAVU_008G220100g [Phaseolus vulgaris] Length = 834 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAEPEAPKADE 192 GDE+LNTLKLALHCVDPSP+ARPE QQV+QQLEEI PE++ S + P E Sbjct: 781 GDEMLNTLKLALHCVDPSPSARPEVQQVLQQLEEIRPEISASSGDDGAIPSTSE 834 >ref|XP_003516400.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Glycine max] Length = 859 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELA 234 GDELLNTLKLALHCVDPSPAARPE QQV+QQLEEI P+LA Sbjct: 807 GDELLNTLKLALHCVDPSPAARPEVQQVLQQLEEIKPDLA 846 >ref|XP_003545217.2| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Glycine max] Length = 826 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAEPEA 207 GDE+LNTLKLALHCVDPSP+ARPE QQV+QQLEEI PE++ S + A Sbjct: 772 GDEMLNTLKLALHCVDPSPSARPEVQQVLQQLEEIRPEISAASSGDDGA 820 >ref|XP_006481114.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Citrus sinensis] Length = 828 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 GDELLNTLKLALHCVDPSPAARPE QV+QQLEEI PELA S Sbjct: 774 GDELLNTLKLALHCVDPSPAARPEVLQVLQQLEEIKPELATGS 816 >ref|XP_006429492.1| hypothetical protein CICLE_v10011081mg [Citrus clementina] gi|557531549|gb|ESR42732.1| hypothetical protein CICLE_v10011081mg [Citrus clementina] Length = 828 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 GDELLNTLKLALHCVDPSPAARPE QV+QQLEEI PELA S Sbjct: 774 GDELLNTLKLALHCVDPSPAARPEVLQVLQQLEEIKPELATGS 816 >ref|XP_004506813.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Cicer arietinum] Length = 798 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAE 231 GDELLNTLKLALHCVDPSPAARP+ +QV+QQLEEI PEL E Sbjct: 739 GDELLNTLKLALHCVDPSPAARPDVKQVLQQLEEIKPELVE 779 >ref|XP_004308965.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3-like [Fragaria vesca subsp. vesca] Length = 776 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 GDELLNTLKLALHCVDPSP+ARPE QQV+QQLEEI PE A S Sbjct: 718 GDELLNTLKLALHCVDPSPSARPEVQQVLQQLEEIRPETAASS 760 >ref|XP_004305103.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Fragaria vesca subsp. vesca] Length = 814 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/52 (75%), Positives = 42/52 (80%), Gaps = 2/52 (3%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAE--PEAP 204 GD+LLNTLKLALHCVDP+PAARPEAQQV+QQLEEI P A AE EAP Sbjct: 758 GDQLLNTLKLALHCVDPTPAARPEAQQVLQQLEEIKPPEANVGSAEEGTEAP 809 >ref|XP_004166117.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat receptor-like protein kinase IMK3-like [Cucumis sativus] Length = 844 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 GDELLNTLKLALHCVDPSP+ARPE QQV+QQLEEI PE A S Sbjct: 784 GDELLNTLKLALHCVDPSPSARPEVQQVLQQLEEIRPETAPSS 826 >ref|XP_004146459.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Cucumis sativus] Length = 844 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 GDELLNTLKLALHCVDPSP+ARPE QQV+QQLEEI PE A S Sbjct: 783 GDELLNTLKLALHCVDPSPSARPEVQQVLQQLEEIRPETAPSS 825 >ref|XP_003522034.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Glycine max] Length = 859 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/54 (70%), Positives = 42/54 (77%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAEPEAPKADE 192 GDELLNTLKLALHCVDPSPAARPE QV+QQLEEI P+LA + + KA E Sbjct: 807 GDELLNTLKLALHCVDPSPAARPEVHQVLQQLEEIKPDLA---SGDDDGAKAQE 857 >ref|XP_003604522.1| Receptor-like kinase [Medicago truncatula] gi|355505577|gb|AES86719.1| Receptor-like kinase [Medicago truncatula] Length = 794 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAE 231 GDELLNTLKLALHCVDPSP+ARPE +QV+QQLEEI PEL E Sbjct: 740 GDELLNTLKLALHCVDPSPSARPEVKQVLQQLEEIKPELVE 780 >ref|XP_002323617.2| LRR-kinase family protein [Populus trichocarpa] gi|550321429|gb|EEF05378.2| LRR-kinase family protein [Populus trichocarpa] Length = 826 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 350 DELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKA 219 DELLNTLKLALHCVDP+PAARPEA+QV+QQLEEI PELA + A Sbjct: 770 DELLNTLKLALHCVDPTPAARPEAEQVVQQLEEIKPELAAAAAA 813 >ref|XP_004240887.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Solanum lycopersicum] Length = 832 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPSKAEPEAPKAD 195 GDELLNTLKLALHCVDPSP+ARPE QQ++QQLEEI PE A S + A D Sbjct: 780 GDELLNTLKLALHCVDPSPSARPEVQQLLQQLEEIRPETATSSGDDGAAASDD 832 >ref|XP_003604527.1| Receptor-like kinase RHG1 [Medicago truncatula] gi|355505582|gb|AES86724.1| Receptor-like kinase RHG1 [Medicago truncatula] Length = 105 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAE 231 GDELLNTLKLALHCVDPSP+ARPE +Q++QQLEEI PEL E Sbjct: 32 GDELLNTLKLALHCVDPSPSARPEVKQILQQLEEIKPELVE 72 >gb|ESW06636.1| hypothetical protein PHAVU_010G064300g [Phaseolus vulgaris] Length = 851 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELA 234 GDELLNTLKLALHCVDPSP+ARPE QV+QQLEEI PELA Sbjct: 799 GDELLNTLKLALHCVDPSPSARPEVHQVLQQLEEIKPELA 838 >gb|EOY07065.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508715170|gb|EOY07067.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508715171|gb|EOY07068.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508715172|gb|EOY07069.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508715173|gb|EOY07070.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508715174|gb|EOY07071.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508715175|gb|EOY07072.1| Inflorescence meristem receptor-like kinase 2 isoform 1 [Theobroma cacao] Length = 853 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 350 DELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 DELLNTLKLALHCVDPSPAARPE QQV+QQLEEI PE+A S Sbjct: 800 DELLNTLKLALHCVDPSPAARPEVQQVLQQLEEIKPEVAAGS 841 >ref|XP_002264565.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Vitis vinifera] Length = 849 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 353 GDELLNTLKLALHCVDPSPAARPEAQQVMQQLEEIMPELAEPS 225 GDELLNTLKL LHCVDPSPAARP+ QQV+QQLEEI PEL S Sbjct: 794 GDELLNTLKLGLHCVDPSPAARPDVQQVLQQLEEIKPELGATS 836