BLASTX nr result
ID: Zingiber23_contig00040439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00040439 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 56 4e-06 ref|XP_006482142.1| PREDICTED: U-box domain-containing protein 4... 55 7e-06 gb|ESW35393.1| hypothetical protein PHAVU_001G231600g [Phaseolus... 55 7e-06 ref|XP_006430636.1| hypothetical protein CICLE_v10012286mg [Citr... 55 7e-06 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 314 QISMEQSLRHLQRRALVCTPKDLPPGNRRSEVSSK 210 Q+SMEQSLRHLQ+RA+VCTP DLP N SEVSSK Sbjct: 344 QVSMEQSLRHLQQRAVVCTPTDLPINNCTSEVSSK 378 >ref|XP_006482142.1| PREDICTED: U-box domain-containing protein 4-like [Citrus sinensis] Length = 397 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 314 QISMEQSLRHLQRRALVCTPKDLPPGNRRSEVSSK 210 Q+SMEQSLRHLQ+RALVCTP DLP + SEVSSK Sbjct: 363 QVSMEQSLRHLQQRALVCTPADLPIASVTSEVSSK 397 >gb|ESW35393.1| hypothetical protein PHAVU_001G231600g [Phaseolus vulgaris] Length = 387 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 314 QISMEQSLRHLQRRALVCTPKDLPPGNRRSEVSSK 210 Q+SMEQSLRHLQ+RALVCTP DLP SEVSSK Sbjct: 353 QVSMEQSLRHLQQRALVCTPSDLPIAGCASEVSSK 387 >ref|XP_006430636.1| hypothetical protein CICLE_v10012286mg [Citrus clementina] gi|557532693|gb|ESR43876.1| hypothetical protein CICLE_v10012286mg [Citrus clementina] Length = 308 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 314 QISMEQSLRHLQRRALVCTPKDLPPGNRRSEVSSK 210 Q+SMEQSLRHLQ+RALVCTP DLP + SEVSSK Sbjct: 274 QVSMEQSLRHLQQRALVCTPADLPIASVTSEVSSK 308