BLASTX nr result
ID: Zingiber23_contig00040321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00040321 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM07281.1| Putative expressed protein [Musa balbisiana] 60 4e-07 >emb|CCM07281.1| Putative expressed protein [Musa balbisiana] Length = 177 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -3 Query: 149 ESAYRSRHQPSALAFTLFSYADLVLLFHCLMVFERLGPDATPRKKEGLK 3 ESAYRSRH +AF +F+Y DLV+L CL FE+L P++ P K+E LK Sbjct: 54 ESAYRSRHDLPMVAFIVFAYVDLVMLLFCLKQFEKLSPESAPAKREQLK 102