BLASTX nr result
ID: Zingiber23_contig00039902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00039902 (550 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Popu... 56 5e-06 >ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa] gi|222852017|gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa] Length = 1468 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = +3 Query: 189 PPDPETFARSYQLEVLEKAKKENMIVFLEMGSRKTLITII 308 P DP FARSYQLE LEKA K N IVFLE GS KTLI I+ Sbjct: 15 PADPLPFARSYQLEALEKALKHNTIVFLETGSGKTLIAIM 54