BLASTX nr result
ID: Zingiber23_contig00039868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00039868 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX99738.1| Teosinte branched 1 isoform 1 [Theobroma cacao] g... 41 8e-06 >gb|EOX99738.1| Teosinte branched 1 isoform 1 [Theobroma cacao] gi|508707843|gb|EOX99739.1| Teosinte branched 1 isoform 1 [Theobroma cacao] Length = 294 Score = 41.2 bits (95), Expect(2) = 8e-06 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = +1 Query: 157 LPGLELGLSQHPQVGIFNPHSLSHFYHHVGQ 249 +PGLELGLSQ P G+ N + S FY +GQ Sbjct: 239 VPGLELGLSQDPHFGVLNSQAFSQFYQQMGQ 269 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = +2 Query: 35 SFPRVGFNGLEWPGSSINPMSFTSLLSGQKQ 127 + P+ GF+GLE+P ++ +SF+SLL+G Q Sbjct: 207 NIPKYGFHGLEFPHMNMGFVSFSSLLNGSNQ 237