BLASTX nr result
ID: Zingiber23_contig00038944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00038944 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136259.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 gb|EXC16677.1| hypothetical protein L484_007723 [Morus notabilis] 97 3e-18 ref|XP_002532248.1| pentatricopeptide repeat-containing protein,... 96 5e-18 ref|XP_006338085.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 ref|XP_004237977.1| PREDICTED: pentatricopeptide repeat-containi... 92 9e-17 ref|XP_002283907.2| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 gb|EOY33044.1| Pentatricopeptide repeat superfamily protein isof... 91 2e-16 ref|XP_002873896.1| pentatricopeptide repeat-containing protein ... 91 2e-16 gb|ESW09636.1| hypothetical protein PHAVU_009G143500g, partial [... 90 4e-16 ref|NP_974803.1| pentatricopeptide repeat-containing protein [Ar... 90 4e-16 ref|XP_003527867.1| PREDICTED: pentatricopeptide repeat-containi... 89 5e-16 ref|XP_006287559.1| hypothetical protein CARUB_v10000770mg [Caps... 89 8e-16 ref|XP_006433856.1| hypothetical protein CICLE_v10000867mg [Citr... 88 1e-15 ref|XP_006472504.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_006403586.1| hypothetical protein EUTSA_v10010303mg [Eutr... 86 4e-15 gb|EPS69387.1| hypothetical protein M569_05378, partial [Genlise... 86 5e-15 ref|XP_004501623.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 ref|XP_006397463.1| hypothetical protein EUTSA_v10001849mg, part... 85 9e-15 ref|XP_004301354.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 83 3e-14 ref|XP_002301082.1| hypothetical protein POPTR_0002s10380g [Popu... 83 3e-14 >ref|XP_004136259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Cucumis sativus] gi|449497032|ref|XP_004160294.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Cucumis sativus] Length = 504 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/101 (46%), Positives = 75/101 (74%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F AID + H+M+++ C+ HE IFL L+ ++S+ ++ L +F + I +VR KPSLK Sbjct: 97 KKFQAIDGVLHQMTYDTCKVHEGIFLNLMKHFSKSSMHERVLDMF-YAIKSIVREKPSLK 155 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ LVES R +LA++LL +ARS+ ++ PNTC+ NIL Sbjct: 156 AISTCLNLLVESDRVDLARKLLVNARSKLNLRPNTCIFNIL 196 >gb|EXC16677.1| hypothetical protein L484_007723 [Morus notabilis] Length = 513 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/101 (46%), Positives = 69/101 (68%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F AIDA+ +M +E C+FHEPIFL L+ + +L +K L +F I + R KPSLK Sbjct: 110 KKFGAIDAILRQMMYETCKFHEPIFLNLMKHFSKYALHEKVLEMFH-AIRSIAREKPSLK 168 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ LVE+ R +LA++ L +R S+ PNTC+ NIL Sbjct: 169 AISTCLNLLVEANRIDLARQFLMHSRKNLSLKPNTCIFNIL 209 >ref|XP_002532248.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528066|gb|EEF30142.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 521 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/101 (46%), Positives = 71/101 (70%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DAL H+M++E C+FHE IFL L+ ++SL ++ L +F + I +VR KPSLK Sbjct: 106 KKFHAVDALLHQMTYETCKFHENIFLNLMKHFYKSSLHERVLEMF-YAIQPIVREKPSLK 164 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ LVES++ +LAQ+ L + PNTC+ NIL Sbjct: 165 AISTCLNILVESKQIDLAQKCLLYVNEHLKVRPNTCIFNIL 205 >ref|XP_006338085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Solanum tuberosum] Length = 511 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/101 (41%), Positives = 69/101 (68%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F +DA+ H+M +E C+FHE +F L+ ++SL +K L +F +P+ VR KPSL Sbjct: 107 KKFETVDAIIHQMKYETCKFHEGVFTNLMKHYSKSSLHEKVLEMFNAILPI-VREKPSLN 165 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L+E+++ ELA+E L + + + PNTC+ NIL Sbjct: 166 AISTCLNLLIEAKQIELAKEFLLNVQKHLDLKPNTCIFNIL 206 >ref|XP_004237977.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Solanum lycopersicum] Length = 511 Score = 91.7 bits (226), Expect = 9e-17 Identities = 43/101 (42%), Positives = 69/101 (68%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F ++A+ H+M +E C+FHE +F L+ R+SL +K L +F +P+ VR KPSL Sbjct: 107 KKFETVEAIIHQMKYETCKFHEGVFTNLMKHYSRSSLHEKVLEMFDAILPI-VREKPSLN 165 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ LVE+++ ELA+E L + + + PNTC+ NIL Sbjct: 166 AISTCLNLLVEAKQIELAKEFLLNVQKHLYLKPNTCIFNIL 206 >ref|XP_002283907.2| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Vitis vinifera] Length = 513 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/101 (43%), Positives = 71/101 (70%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F AIDA+ H+M++E C+FHE IFL L+ + SL ++ + +F P+ VR KPSLK Sbjct: 107 KKFQAIDAVLHQMTYETCKFHEGIFLNLMKHFSKLSLHERVVEMFDAIRPI-VREKPSLK 165 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ LVES + +L ++ L +++ ++ PNTC+ NIL Sbjct: 166 AISTCLNLLVESNQVDLTRKFLLNSKKSLNLEPNTCIFNIL 206 >gb|EOY33044.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508785789|gb|EOY33045.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 530 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/101 (42%), Positives = 70/101 (69%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F AID++ +M++E C+FHE +FL L+ + SL D+ L +F + I +VR KPSLK Sbjct: 109 KKFQAIDSILRQMTYETCKFHEGVFLNLMKHFSKFSLHDRVLEMF-YAIQPIVREKPSLK 167 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L+ES + +LA+ L +++ + PNTC+ NIL Sbjct: 168 AISTCLNLLIESNQVDLARHFLLNSKKSLRLRPNTCIFNIL 208 >ref|XP_002873896.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319733|gb|EFH50155.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 507 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/101 (42%), Positives = 67/101 (66%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ H+M +E CRF E +FL L+ R L DK + +F I ++ R KPSL Sbjct: 104 KKFLAVDAILHQMKYETCRFQESLFLNLMRHFSRFDLHDKVMEMFNL-IQVIARVKPSLN 162 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L++S +LA++LL A+ ++ PNTC+ NIL Sbjct: 163 AISTCLNLLIDSGEVDLARKLLLYAKHNLALQPNTCIFNIL 203 >gb|ESW09636.1| hypothetical protein PHAVU_009G143500g, partial [Phaseolus vulgaris] Length = 742 Score = 89.7 bits (221), Expect = 4e-16 Identities = 46/100 (46%), Positives = 67/100 (67%) Frame = -2 Query: 300 RFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLKA 121 +F A+D + H+M++E C+FHE IF+ L+ ++SL DK L F F I +VR KPS KA Sbjct: 112 KFHAVDRVLHQMTYETCKFHEGIFVNLMSHFSKSSLHDKVLQAF-FSIQPIVRDKPSPKA 170 Query: 120 LATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 L TCL+ L++S R +LA++LL A+ + PN C+ NIL Sbjct: 171 LTTCLNLLLDSNRVDLARKLLLHAKRGLTHKPNVCIFNIL 210 >ref|NP_974803.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122214363|sp|Q3E9F0.1|PP392_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g18475 gi|110737103|dbj|BAF00503.1| hypothetical protein [Arabidopsis thaliana] gi|332005185|gb|AED92568.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 506 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/101 (41%), Positives = 66/101 (65%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ H+M +E CRF E +FL L+ R+ L DK + +F I ++ R KPSL Sbjct: 103 KKFLAVDAILHQMKYETCRFQESLFLNLMRHFSRSDLHDKVMEMFNL-IQVIARVKPSLN 161 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L++S L+++LL A+ + PNTC+ NIL Sbjct: 162 AISTCLNLLIDSGEVNLSRKLLLYAKHNLGLQPNTCIFNIL 202 >ref|XP_003527867.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Glycine max] Length = 546 Score = 89.4 bits (220), Expect = 5e-16 Identities = 46/99 (46%), Positives = 68/99 (68%) Frame = -2 Query: 297 FAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLKAL 118 F A+D + H+M++E C+FHE IF+ L+ ++SL +K LH + F I +VR KPS KAL Sbjct: 142 FHAVDRVLHQMTYETCKFHEGIFVNLMKHFSKSSLHEKLLHAY-FSIQPIVREKPSPKAL 200 Query: 117 ATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 +TCL+ L++S R +LA++LL A+ + PN CV NIL Sbjct: 201 STCLNLLLDSNRVDLARKLLLHAKRDLTRKPNVCVFNIL 239 >ref|XP_006287559.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] gi|565459122|ref|XP_006287560.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] gi|482556265|gb|EOA20457.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] gi|482556266|gb|EOA20458.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] Length = 506 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/101 (41%), Positives = 65/101 (64%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ H+M +E CRF E +FL L+ R L DK + +F I ++ R KPSLK Sbjct: 103 KKFLAVDAILHQMRYETCRFEESLFLNLMRHFSRFDLHDKVMDMFNL-IQVIARVKPSLK 161 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 +++TCL+ L+++ LA+ LL A+ + PNTC+ NIL Sbjct: 162 SISTCLNLLIDAGEINLARNLLLYAKHNLGLQPNTCIFNIL 202 >ref|XP_006433856.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] gi|567882597|ref|XP_006433857.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] gi|557535978|gb|ESR47096.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] gi|557535979|gb|ESR47097.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] Length = 521 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/101 (42%), Positives = 65/101 (64%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ +M++E C+FHE IFL L+ SL ++ L +F P+ R KPSLK Sbjct: 109 KKFQAVDAVLRQMTYETCKFHEGIFLNLMKHFSNCSLHERVLEMFHKIHPI-TREKPSLK 167 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L+ES + +LAQ L + + PNTC+ NIL Sbjct: 168 AISTCLNLLIESNQVDLAQNFLKYSNQHLRLKPNTCIFNIL 208 >ref|XP_006472504.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X1 [Citrus sinensis] gi|568836969|ref|XP_006472505.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X2 [Citrus sinensis] Length = 521 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/101 (42%), Positives = 65/101 (64%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ +M++E C+FHE IFL L+ SL ++ L +F P+ R KPSLK Sbjct: 109 KKFEAVDAVLRQMTYETCKFHEGIFLNLMKHFSNCSLHERVLEMFHKIHPI-TREKPSLK 167 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L+ES + +LAQ L + + PNTC+ NIL Sbjct: 168 AISTCLNLLIESNQVDLAQNFLKYSNRHLRLKPNTCIFNIL 208 >ref|XP_006403586.1| hypothetical protein EUTSA_v10010303mg [Eutrema salsugineum] gi|557104705|gb|ESQ45039.1| hypothetical protein EUTSA_v10010303mg [Eutrema salsugineum] Length = 505 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/101 (40%), Positives = 67/101 (66%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ ++M +E CRF E +FL L+ R L +K + +F I ++ R KPSL Sbjct: 102 KKFQAVDAILNQMKYETCRFQEGVFLNLMRHYSRFDLHEKVMEMFNL-ILMIARVKPSLN 160 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ L++S +LA++LL A++ + PNTC+ NIL Sbjct: 161 AISTCLNLLIDSGEVDLARKLLLYAKNHLGLQPNTCIFNIL 201 >gb|EPS69387.1| hypothetical protein M569_05378, partial [Genlisea aurea] Length = 449 Score = 85.9 bits (211), Expect = 5e-15 Identities = 44/101 (43%), Positives = 62/101 (61%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 R ++D HRM++E CRFHE IFL L+ + S+ D+ + +F P+ R KPS K Sbjct: 52 RNHDSLDNALHRMTYETCRFHEGIFLTLMKHFAKLSMADRVVEMFHRIHPI-TRSKPSPK 110 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A+ TCL+ LVE+ LA+ LL R F +VPN+C+ NIL Sbjct: 111 AITTCLNLLVEANEISLARALLLGLRRDFRLVPNSCIFNIL 151 >ref|XP_004501623.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X1 [Cicer arietinum] gi|502133024|ref|XP_004501624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X2 [Cicer arietinum] Length = 510 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/101 (42%), Positives = 66/101 (65%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+D + H+M++E C+FHE IF+ L+ + S +K L F F I +VR KPS K Sbjct: 104 KKFQAVDRVLHQMTYETCQFHEGIFINLMKHYSKCSFHEKVLDAF-FSIQPIVREKPSPK 162 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A++TCL+ LV+S + +LA++LL A+ PN C+ NIL Sbjct: 163 AISTCLNLLVDSNQVDLARQLLLHAKRSLIYKPNVCIFNIL 203 >ref|XP_006397463.1| hypothetical protein EUTSA_v10001849mg, partial [Eutrema salsugineum] gi|557098529|gb|ESQ38916.1| hypothetical protein EUTSA_v10001849mg, partial [Eutrema salsugineum] Length = 225 Score = 85.1 bits (209), Expect = 9e-15 Identities = 43/101 (42%), Positives = 64/101 (63%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ ++M +E CRF E +FL L+ R L DK + +F I ++ R K SL Sbjct: 14 KKFQAVDAILNQMKYETCRFQEGVFLNLMRHYSRFDLHDKVMEMFNL-IQVIARMKLSLN 72 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 A+ TCL+ L++S ELA+ELL A++ + PNTC NIL Sbjct: 73 AITTCLNLLIDSWEVELARELLLYAKNHLGLHPNTCTFNIL 113 >ref|XP_004301354.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g18475-like [Fragaria vesca subsp. vesca] Length = 568 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/101 (37%), Positives = 67/101 (66%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DA+ ++M ++ C+FHE IFL L+ + S+ ++ L +F P+ VR KPSLK Sbjct: 161 KKFKAVDAVLYQMKYDTCKFHEGIFLNLMKHFSKFSMHERVLEMFHAIQPI-VREKPSLK 219 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNIL 1 ++TCL+ L+E+ + ++AQ+ L + ++ NTC+ NIL Sbjct: 220 CISTCLNLLIEANQVDMAQQFLMHLKKSLNLKLNTCIANIL 260 >ref|XP_002301082.1| hypothetical protein POPTR_0002s10380g [Populus trichocarpa] gi|222842808|gb|EEE80355.1| hypothetical protein POPTR_0002s10380g [Populus trichocarpa] Length = 509 Score = 83.2 bits (204), Expect = 3e-14 Identities = 41/100 (41%), Positives = 65/100 (65%) Frame = -2 Query: 303 RRFAAIDALFHRMSFEPCRFHEPIFLRLIPLLCRASLPDKALHIFRFPIPLLVRCKPSLK 124 ++F A+DAL +M +E C+FHE +FL L+ ++S ++ + +F I +VR KPSLK Sbjct: 97 KKFQAVDALLRQMMYETCKFHESLFLNLMKYFAKSSEFERVVEMFN-KIQPIVREKPSLK 155 Query: 123 ALATCLDSLVESQRFELAQELLSDARSRFSIVPNTCVCNI 4 A++TCL+ LVES++ +L + L D + PNTC+ NI Sbjct: 156 AISTCLNLLVESKQVDLLRGFLLDLNKDHMLKPNTCIFNI 195