BLASTX nr result
ID: Zingiber23_contig00038930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00038930 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67523.1| hypothetical protein VITISV_020207 [Vitis vinifera] 56 6e-06 >emb|CAN67523.1| hypothetical protein VITISV_020207 [Vitis vinifera] Length = 1817 Score = 55.8 bits (133), Expect = 6e-06 Identities = 46/118 (38%), Positives = 62/118 (52%), Gaps = 9/118 (7%) Frame = +1 Query: 94 DTDDAGLLGDVLCLSLHDDAVKSDEAYSDESKVDSFEDIMKQLNEIFASTEDEAGPVFAK 273 D DD L D L LS + AVK + A S+ES + + +KQ NE+ S E P K Sbjct: 130 DPDD--LQQDALGLSSSNLAVKINGACSEESDAGTSKRGLKQFNEMSGS--GEIVPKNLK 185 Query: 274 GSEGNFL---------DYNFLQDEISRLSMENQELKKQMYSESSRADKSENDVRCLKE 420 SEG + LQ +S+LS EN+ LK Q+ SES RA K+E +++ LKE Sbjct: 186 LSEGRIKKGLSVQIEEQAHSLQGGLSQLSSENRTLKLQVLSESERASKAETEIKTLKE 243