BLASTX nr result
ID: Zingiber23_contig00038912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00038912 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB41187.1| hypothetical protein L484_005223 [Morus notabilis] 55 7e-06 >gb|EXB41187.1| hypothetical protein L484_005223 [Morus notabilis] Length = 622 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = -1 Query: 171 NRLQAMPLLHLEQSVDR---RTNYTITLLSRQGRMFDARQLFDKTPHKDVISWTSIISGY 1 N + LL + SV+ R+N+ +T LS+ GR+ DARQ+FD+ P +DVI+WT++I+GY Sbjct: 25 NNAPKILLLERDYSVNSGVARSNWWLTKLSKSGRIGDARQVFDEMPDRDVITWTTVITGY 84