BLASTX nr result
ID: Zingiber23_contig00038846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00038846 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828340.1| hypothetical protein AMTR_s00023p00247850 [A... 55 1e-05 >ref|XP_006828340.1| hypothetical protein AMTR_s00023p00247850 [Amborella trichopoda] gi|548832987|gb|ERM95756.1| hypothetical protein AMTR_s00023p00247850 [Amborella trichopoda] Length = 400 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 373 LSQAQQEKKSRFIPVKAYFLCTSIDLRSLQ 462 L + QQEK+SRFIPVKAYFLCTSIDLRSLQ Sbjct: 102 LLEVQQEKQSRFIPVKAYFLCTSIDLRSLQ 131