BLASTX nr result
ID: Zingiber23_contig00038764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00038764 (322 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004984280.1| PREDICTED: CST complex subunit STN1-like [Se... 68 1e-09 ref|XP_002465223.1| hypothetical protein SORBIDRAFT_01g034490 [S... 68 1e-09 gb|EMS59713.1| CST complex subunit STN1 [Triticum urartu] 66 4e-09 gb|ACN27497.1| unknown [Zea mays] gi|413955646|gb|AFW88295.1| OB... 65 7e-09 gb|EMS53436.1| CST complex subunit STN1 [Triticum urartu] 64 2e-08 ref|NP_001050181.1| Os03g0366900 [Oryza sativa Japonica Group] g... 64 3e-08 ref|XP_006650114.1| PREDICTED: CST complex subunit STN1-like [Or... 62 6e-08 ref|XP_003632321.1| PREDICTED: CST complex subunit STN1-like [Vi... 62 6e-08 ref|XP_006345383.1| PREDICTED: CST complex subunit STN1-like [So... 61 1e-07 ref|XP_004231127.1| PREDICTED: CST complex subunit STN1-like [So... 61 1e-07 ref|XP_003557913.1| PREDICTED: CST complex subunit STN1-like [Br... 61 1e-07 gb|EEC75328.1| hypothetical protein OsI_11709 [Oryza sativa Indi... 60 2e-07 gb|EXB93354.1| CST complex subunit STN1 [Morus notabilis] 60 4e-07 ref|XP_006444029.1| hypothetical protein CICLE_v10022619mg [Citr... 59 5e-07 ref|XP_004145384.1| PREDICTED: CST complex subunit STN1-like [Cu... 59 5e-07 ref|NP_001151468.1| OB-fold nucleic acid binding domain containi... 59 7e-07 ref|XP_002307601.1| OB-fold nucleic acid binding domain-containi... 59 9e-07 ref|XP_001760977.1| predicted protein [Physcomitrella patens] gi... 57 2e-06 ref|XP_004513907.1| PREDICTED: CST complex subunit STN1-like [Ci... 57 3e-06 gb|ADE77185.1| unknown [Picea sitchensis] 56 4e-06 >ref|XP_004984280.1| PREDICTED: CST complex subunit STN1-like [Setaria italica] Length = 163 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTPA 120 G++Q+ VRDV++E+DPN+EVLHWL C+RLAK CYDLP P+ Sbjct: 119 GAIQIAVRDVVLEKDPNVEVLHWLQCVRLAKECYDLPPPS 158 >ref|XP_002465223.1| hypothetical protein SORBIDRAFT_01g034490 [Sorghum bicolor] gi|241919077|gb|EER92221.1| hypothetical protein SORBIDRAFT_01g034490 [Sorghum bicolor] Length = 164 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLP 111 G++Q+TVRDV+VE+DPN EVLHWL C+RLAK CYDLP Sbjct: 120 GAIQITVRDVVVEKDPNSEVLHWLQCVRLAKECYDLP 156 >gb|EMS59713.1| CST complex subunit STN1 [Triticum urartu] Length = 156 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTPA 120 G++Q+ RDV++E+DPNMEVLHWL CI +AK CYDLP P+ Sbjct: 116 GAIQIAARDVVLEEDPNMEVLHWLQCIHMAKECYDLPLPS 155 >gb|ACN27497.1| unknown [Zea mays] gi|413955646|gb|AFW88295.1| OB-fold nucleic acid binding domain containing protein [Zea mays] Length = 165 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLP 111 G++Q+TVRDV+ E+DPN EVLHWL C+RLAK CYDLP Sbjct: 121 GAIQITVRDVVPEKDPNSEVLHWLQCVRLAKECYDLP 157 >gb|EMS53436.1| CST complex subunit STN1 [Triticum urartu] Length = 156 Score = 64.3 bits (155), Expect = 2e-08 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTPA 120 G++Q+ RDV++E+DPN+EVLHWL C+ +AK CYDLP P+ Sbjct: 116 GAIQIAARDVVLEEDPNVEVLHWLQCVHMAKECYDLPLPS 155 >ref|NP_001050181.1| Os03g0366900 [Oryza sativa Japonica Group] gi|108708339|gb|ABF96134.1| OB-fold nucleic acid binding domain containing protein, expressed [Oryza sativa Japonica Group] gi|113548652|dbj|BAF12095.1| Os03g0366900 [Oryza sativa Japonica Group] gi|215701028|dbj|BAG92452.1| unnamed protein product [Oryza sativa Japonica Group] gi|222624978|gb|EEE59110.1| hypothetical protein OsJ_10972 [Oryza sativa Japonica Group] Length = 160 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTPA 120 G++Q+ VRDV++E+DPN+EV+HWL CIR+AK CYDL P+ Sbjct: 120 GAIQIAVRDVVLEKDPNVEVMHWLQCIRMAKECYDLRPPS 159 >ref|XP_006650114.1| PREDICTED: CST complex subunit STN1-like [Oryza brachyantha] Length = 160 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTPA 120 G++Q+ VRDV++E+DPN+EVLHWL C+ +AK CYDL P+ Sbjct: 120 GAIQIAVRDVVLEKDPNVEVLHWLQCVHMAKECYDLQPPS 159 >ref|XP_003632321.1| PREDICTED: CST complex subunit STN1-like [Vitis vinifera] gi|147810449|emb|CAN65336.1| hypothetical protein VITISV_023849 [Vitis vinifera] Length = 165 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/36 (66%), Positives = 34/36 (94%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDL 108 G++Q+TV +V+VE+DPNME+LHWLDCI+LA+ CYD+ Sbjct: 125 GTVQITVSNVIVERDPNMEILHWLDCIKLARKCYDV 160 >ref|XP_006345383.1| PREDICTED: CST complex subunit STN1-like [Solanum tuberosum] Length = 164 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYD 105 G+LQ+TV DV++E+DPN ++LHWLDC+RLA+ CYD Sbjct: 122 GNLQITVSDVVIERDPNSQILHWLDCLRLARNCYD 156 >ref|XP_004231127.1| PREDICTED: CST complex subunit STN1-like [Solanum lycopersicum] Length = 164 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYD 105 G+LQ+TV DV++E+DPN ++LHWLDC+RLA+ CYD Sbjct: 122 GNLQITVSDVVIERDPNSQILHWLDCLRLARNCYD 156 >ref|XP_003557913.1| PREDICTED: CST complex subunit STN1-like [Brachypodium distachyon] Length = 159 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/39 (56%), Positives = 33/39 (84%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTP 117 G++Q+ VRDV++E+DPN+E+LHWL C+ +AK C+D P P Sbjct: 119 GAMQIAVRDVILEKDPNVELLHWLQCVHMAKECFDFPLP 157 >gb|EEC75328.1| hypothetical protein OsI_11709 [Oryza sativa Indica Group] Length = 327 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTPA 120 G++Q+ VRDV++E+DPN+EV+HWL CI +AK CYDL P+ Sbjct: 287 GAIQIAVRDVVLEKDPNVEVMHWLQCICMAKECYDLRPPS 326 >gb|EXB93354.1| CST complex subunit STN1 [Morus notabilis] Length = 164 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = +1 Query: 7 LQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTP 117 +Q+TV DV+V++DPN E+LHWLDC+RLA+ CYD+ P Sbjct: 126 VQITVSDVVVDRDPNAEILHWLDCMRLARRCYDVVAP 162 >ref|XP_006444029.1| hypothetical protein CICLE_v10022619mg [Citrus clementina] gi|568852028|ref|XP_006479683.1| PREDICTED: CST complex subunit STN1-like [Citrus sinensis] gi|557546291|gb|ESR57269.1| hypothetical protein CICLE_v10022619mg [Citrus clementina] Length = 160 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDL 108 G +Q+TV DV++E+DPNMEVLHWLDC+RLA+ YD+ Sbjct: 120 GDVQITVSDVVIEKDPNMEVLHWLDCLRLARKRYDV 155 >ref|XP_004145384.1| PREDICTED: CST complex subunit STN1-like [Cucumis sativus] gi|449474220|ref|XP_004154109.1| PREDICTED: CST complex subunit STN1-like [Cucumis sativus] gi|449526303|ref|XP_004170153.1| PREDICTED: CST complex subunit STN1-like [Cucumis sativus] Length = 168 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDL-PTP 117 G +Q+TV DV+VE DPN E+LHWLD +RLA CYDL PTP Sbjct: 128 GMVQITVSDVVVEDDPNAEILHWLDSMRLAMKCYDLSPTP 167 >ref|NP_001151468.1| OB-fold nucleic acid binding domain containing protein [Zea mays] gi|195646980|gb|ACG42958.1| OB-fold nucleic acid binding domain containing protein [Zea mays] Length = 164 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLP 111 G++Q+TVRDV V DPN +VLHWL C+RLAK CYDLP Sbjct: 121 GAIQITVRDV-VPNDPNSDVLHWLQCVRLAKECYDLP 156 >ref|XP_002307601.1| OB-fold nucleic acid binding domain-containing family protein [Populus trichocarpa] gi|222857050|gb|EEE94597.1| OB-fold nucleic acid binding domain-containing family protein [Populus trichocarpa] Length = 166 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDL 108 G++Q+TV DV+VE+DPN+E HWLDCIRLA+ CY++ Sbjct: 125 GAVQVTVSDVVVERDPNVEAFHWLDCIRLARNCYNV 160 >ref|XP_001760977.1| predicted protein [Physcomitrella patens] gi|162687986|gb|EDQ74366.1| predicted protein [Physcomitrella patens] Length = 134 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 7 LQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDL 108 +Q+TV + E+DPN EVLHW++C+RLAKCCYDL Sbjct: 90 IQVTVASLRTEKDPNAEVLHWVECMRLAKCCYDL 123 >ref|XP_004513907.1| PREDICTED: CST complex subunit STN1-like [Cicer arietinum] Length = 165 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = +1 Query: 1 GSLQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDL 108 G +Q+TV DV+VE+DPN EVLHW++C+ LA+ CY+L Sbjct: 130 GCVQITVTDVVVERDPNAEVLHWIECVNLARNCYNL 165 >gb|ADE77185.1| unknown [Picea sitchensis] Length = 185 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +1 Query: 7 LQLTVRDVLVEQDPNMEVLHWLDCIRLAKCCYDLPTP 117 LQ+TV +VE+DPN E+LHW++CIRLA CYD+ P Sbjct: 134 LQITVSSAVVEKDPNAEILHWMECIRLAVRCYDMSAP 170