BLASTX nr result
ID: Zingiber23_contig00035462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00035462 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 79 9e-13 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 72 9e-11 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 79.0 bits (193), Expect = 9e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 LGKTDQTYYYRNDLNCFKDPTCILLHWALPSTDVKIS 112 LGKT++TYYYRNDLNCFKDPTCILLHWAL STDVKIS Sbjct: 67 LGKTEKTYYYRNDLNCFKDPTCILLHWALSSTDVKIS 103 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 72.4 bits (176), Expect = 9e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 LGKTDQTYYYRNDLNCFKDPTCILLHWALPSTDVKIS 112 LGKTDQT YYRND NCFKDPTCI LHWAL ST+VKIS Sbjct: 17 LGKTDQTDYYRNDSNCFKDPTCIFLHWALSSTNVKIS 53