BLASTX nr result
ID: Zingiber23_contig00034586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00034586 (658 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citr... 60 4e-07 >ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] gi|557535668|gb|ESR46786.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] Length = 558 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = -1 Query: 658 MKARGLKKLPDSTLIDLNVVVHKFSVGDESQPEILQVYEMLKKIAEQLKLQ 506 MK RG+K P S++ID+N V+H+F GD S P++ ++Y MLKKI E+LK++ Sbjct: 415 MKERGIKTNPGSSMIDVNGVIHEFRTGDGSHPQVKEIYLMLKKIIEKLKME 465