BLASTX nr result
ID: Zingiber23_contig00034056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00034056 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006448969.1| hypothetical protein CICLE_v10014878mg [Citr... 69 5e-10 gb|EXB39503.1| hypothetical protein L484_011420 [Morus notabilis] 69 7e-10 gb|EPS62591.1| hypothetical protein M569_12197, partial [Genlise... 68 1e-09 ref|XP_006468257.1| PREDICTED: uncharacterized protein LOC102620... 67 2e-09 ref|XP_006836326.1| hypothetical protein AMTR_s00092p00069380 [A... 67 2e-09 ref|XP_002531051.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_006410612.1| hypothetical protein EUTSA_v10016502mg [Eutr... 67 2e-09 gb|EOY27582.1| Plastid transcriptionally active 12 isoform 2 [Th... 66 4e-09 gb|EOY27581.1| Plastid transcriptionally active 12 isoform 1 [Th... 66 4e-09 ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251... 66 4e-09 gb|EMJ12747.1| hypothetical protein PRUPE_ppa004073mg [Prunus pe... 65 9e-09 ref|XP_006352977.1| PREDICTED: uncharacterized protein LOC102587... 65 1e-08 ref|NP_001265944.1| Hop-interacting protein THI030 [Solanum lyco... 65 1e-08 ref|XP_004293512.1| PREDICTED: uncharacterized protein LOC101310... 64 2e-08 ref|XP_006295623.1| hypothetical protein CARUB_v10024736mg [Caps... 63 5e-08 ref|XP_002881347.1| PTAC12 [Arabidopsis lyrata subsp. lyrata] gi... 63 5e-08 ref|XP_002298838.2| hypothetical protein POPTR_0001s36880g [Popu... 62 1e-07 ref|XP_004485980.1| PREDICTED: uncharacterized protein LOC101501... 61 2e-07 gb|ESW19946.1| hypothetical protein PHAVU_006G168100g [Phaseolus... 60 2e-07 dbj|BAC42455.2| unknown protein [Arabidopsis thaliana] 60 3e-07 >ref|XP_006448969.1| hypothetical protein CICLE_v10014878mg [Citrus clementina] gi|557551580|gb|ESR62209.1| hypothetical protein CICLE_v10014878mg [Citrus clementina] Length = 530 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKSTPQLR MSLEEA+DDSEN+TDFL+DFDEE+ Sbjct: 481 ITRNWSVLKSTPQLRKSKAKPKKDG-TMSLEEAVDDSENLTDFLLDFDEED 530 >gb|EXB39503.1| hypothetical protein L484_011420 [Morus notabilis] Length = 130 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKSTPQLR MSL+EAIDDSEN+TDFLMDF+EEE Sbjct: 81 ITRNWSVLKSTPQLRKSKEKTKDGP--MSLDEAIDDSENLTDFLMDFEEEE 129 >gb|EPS62591.1| hypothetical protein M569_12197, partial [Genlisea aurea] Length = 475 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 I RNWSVLKS P+LR + MSLEEA+DDSEN+TDFL+DFD+EE Sbjct: 425 IDRNWSVLKSNPELRKSKENKPEKKNKMSLEEAMDDSENLTDFLLDFDQEE 475 >ref|XP_006468257.1| PREDICTED: uncharacterized protein LOC102620035 [Citrus sinensis] Length = 530 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKSTPQL+ MSLEEA+DDSEN+TDFL+DFDEE+ Sbjct: 481 ITRNWSVLKSTPQLQKSKAKPKKDGP-MSLEEAVDDSENLTDFLLDFDEED 530 >ref|XP_006836326.1| hypothetical protein AMTR_s00092p00069380 [Amborella trichopoda] gi|548838844|gb|ERM99179.1| hypothetical protein AMTR_s00092p00069380 [Amborella trichopoda] Length = 529 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKSTP+L D+M+LEEAIDDSEN+TDFLMDF E+E Sbjct: 479 ITRNWSVLKSTPELNNSKKKKPKK-DSMTLEEAIDDSENLTDFLMDFSEDE 528 >ref|XP_002531051.1| conserved hypothetical protein [Ricinus communis] gi|223529346|gb|EEF31312.1| conserved hypothetical protein [Ricinus communis] Length = 524 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 +TRNWSVLKSTPQLR MSLEEAI+DSEN+TDFLMDF EEE Sbjct: 474 VTRNWSVLKSTPQLRKSKAKPKKDG-GMSLEEAIEDSENLTDFLMDFGEEE 523 >ref|XP_006410612.1| hypothetical protein EUTSA_v10016502mg [Eutrema salsugineum] gi|557111781|gb|ESQ52065.1| hypothetical protein EUTSA_v10016502mg [Eutrema salsugineum] Length = 528 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEE 207 + RNWSVLKSTP+LR MSL+EA+DDSEN+TDFLMDF+EE Sbjct: 476 VPRNWSVLKSTPELRNAKPKPKKEAGRMSLDEAVDDSENLTDFLMDFEEE 525 >gb|EOY27582.1| Plastid transcriptionally active 12 isoform 2 [Theobroma cacao] Length = 528 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 I RNWSVLKSTPQL+ D MSLEEA++DSEN+TDFLMDF+E+E Sbjct: 479 IRRNWSVLKSTPQLKKSKAKPKKG-DPMSLEEAVEDSENLTDFLMDFEEDE 528 >gb|EOY27581.1| Plastid transcriptionally active 12 isoform 1 [Theobroma cacao] Length = 518 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 I RNWSVLKSTPQL+ D MSLEEA++DSEN+TDFLMDF+E+E Sbjct: 469 IRRNWSVLKSTPQLKKSKAKPKKG-DPMSLEEAVEDSENLTDFLMDFEEDE 518 >ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251522 [Vitis vinifera] gi|297740769|emb|CBI30951.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKSTPQLR MS+EEA+DDSEN+TDFL+DF+E+E Sbjct: 463 ITRNWSVLKSTPQLRKSKDKPKKEGP-MSVEEAVDDSENLTDFLLDFEEDE 512 >gb|EMJ12747.1| hypothetical protein PRUPE_ppa004073mg [Prunus persica] Length = 531 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEE 207 ITRNWSVLK+TP L DA+SLEEA+DDSEN+TDFLMDF+EE Sbjct: 483 ITRNWSVLKTTPGLTKSKGKPKK--DALSLEEAVDDSENLTDFLMDFEEE 530 >ref|XP_006352977.1| PREDICTED: uncharacterized protein LOC102587072 [Solanum tuberosum] Length = 528 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/51 (64%), Positives = 37/51 (72%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKS P+L MSLEEA+DDSEN+TDFLMDFDE+E Sbjct: 480 ITRNWSVLKSNPELSKSKGKPKNKD--MSLEEAVDDSENLTDFLMDFDEDE 528 >ref|NP_001265944.1| Hop-interacting protein THI030 [Solanum lycopersicum] gi|365222882|gb|AEW69793.1| Hop-interacting protein THI030 [Solanum lycopersicum] Length = 528 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/51 (64%), Positives = 37/51 (72%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSVLKS P+L MSLEEA+DDSEN+TDFLMDFDE+E Sbjct: 480 ITRNWSVLKSNPELSKSKGKPKKKD--MSLEEAVDDSENLTDFLMDFDEDE 528 >ref|XP_004293512.1| PREDICTED: uncharacterized protein LOC101310003 [Fragaria vesca subsp. vesca] Length = 550 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEE 207 ITRNWSVLKSTPQL MSL+EA+DDSEN+TDFLMDF+EE Sbjct: 502 ITRNWSVLKSTPQLTKSKEKPKKGGP-MSLDEAVDDSENLTDFLMDFEEE 550 >ref|XP_006295623.1| hypothetical protein CARUB_v10024736mg [Capsella rubella] gi|482564331|gb|EOA28521.1| hypothetical protein CARUB_v10024736mg [Capsella rubella] Length = 527 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEE 207 + RNWSVLKSTP+LR MSL+EA+DDSEN+TDFLMDF+EE Sbjct: 476 VPRNWSVLKSTPELRTAKPKPKKEG-RMSLDEAVDDSENLTDFLMDFEEE 524 >ref|XP_002881347.1| PTAC12 [Arabidopsis lyrata subsp. lyrata] gi|297327186|gb|EFH57606.1| PTAC12 [Arabidopsis lyrata subsp. lyrata] Length = 527 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEE 207 + RNWSVLKSTP+LR MSL+EA+DDSEN+TDFLMDF+EE Sbjct: 476 VLRNWSVLKSTPELRTAKPKPKKEG-RMSLDEAVDDSENLTDFLMDFEEE 524 >ref|XP_002298838.2| hypothetical protein POPTR_0001s36880g [Populus trichocarpa] gi|550349052|gb|EEE83643.2| hypothetical protein POPTR_0001s36880g [Populus trichocarpa] Length = 527 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEEE 210 ITRNWSV K+TPQ R +SLEEAIDDSEN+TDFLMDF+++E Sbjct: 478 ITRNWSVYKTTPQARKSKDKPKKEGP-LSLEEAIDDSENLTDFLMDFEQDE 527 >ref|XP_004485980.1| PREDICTED: uncharacterized protein LOC101501722 [Cicer arietinum] Length = 543 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/51 (58%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDA-MSLEEAIDDSENITDFLMDFDEE 207 I RNWSVLK+TPQLR + MSLEEA+ DSEN+TDFL+DF++E Sbjct: 493 INRNWSVLKTTPQLRKSKSKPKPKKEGPMSLEEAVGDSENLTDFLLDFEDE 543 >gb|ESW19946.1| hypothetical protein PHAVU_006G168100g [Phaseolus vulgaris] Length = 521 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +1 Query: 70 WSVLKSTPQLRXXXXXXXXXXD-AMSLEEAIDDSENITDFLMDFDEEE 210 WSVLKSTP+LR + AMSL+EA++DSEN+TDFLMDF+EEE Sbjct: 474 WSVLKSTPELRKSKPQPKPKKNGAMSLDEAVEDSENLTDFLMDFEEEE 521 >dbj|BAC42455.2| unknown protein [Arabidopsis thaliana] Length = 527 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +1 Query: 58 ITRNWSVLKSTPQLRXXXXXXXXXXDAMSLEEAIDDSENITDFLMDFDEE 207 + RNWSVLK TP+LR MSL+EA+DD+EN+TDFLMDF+EE Sbjct: 476 VPRNWSVLKETPELRTAKPKPKKEG-RMSLDEAVDDAENLTDFLMDFEEE 524