BLASTX nr result
ID: Zingiber23_contig00033778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00033778 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147410.1| PREDICTED: phospho-N-acetylmuramoyl-pentapep... 56 6e-06 ref|XP_002316728.2| hypothetical protein POPTR_0011s02650g [Popu... 55 1e-05 >ref|XP_004147410.1| PREDICTED: phospho-N-acetylmuramoyl-pentapeptide-transferase homolog [Cucumis sativus] gi|449527335|ref|XP_004170667.1| PREDICTED: phospho-N-acetylmuramoyl-pentapeptide-transferase homolog [Cucumis sativus] Length = 521 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/61 (49%), Positives = 39/61 (63%) Frame = +3 Query: 6 VFHKRASKLLYKRKSRRGIVGTTSIYHYFELCGVQEPLIVGVAYIVSFILALVAGYVGLI 185 V+ K +KL + R I +H+ ELCG++EP IV AY +S ILAL+AGYVGLI Sbjct: 463 VYFKMTTKL---EGAGRHIFQMVPFHHHLELCGIKEPFIVAGAYTISSILALLAGYVGLI 519 Query: 186 S 188 S Sbjct: 520 S 520 >ref|XP_002316728.2| hypothetical protein POPTR_0011s02650g [Populus trichocarpa] gi|550327440|gb|EEE97340.2| hypothetical protein POPTR_0011s02650g [Populus trichocarpa] Length = 398 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 78 IYHYFELCGVQEPLIVGVAYIVSFILALVAGYVGLIS 188 I+H+ ELCG++EP+IV AY++S +LAL AGYVGLIS Sbjct: 361 IHHHLELCGLKEPVIVAGAYVISGVLALFAGYVGLIS 397