BLASTX nr result
ID: Zingiber23_contig00033748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00033748 (546 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847855.1| hypothetical protein AMTR_s00029p00071930 [A... 57 4e-06 >ref|XP_006847855.1| hypothetical protein AMTR_s00029p00071930 [Amborella trichopoda] gi|548851160|gb|ERN09436.1| hypothetical protein AMTR_s00029p00071930 [Amborella trichopoda] Length = 341 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = -1 Query: 267 ITVIICLCTWLYLFPRLRATIQKENATGNDKRGNEEIDLNSKEYKKMVVLKGLLERD 97 + IIC WL L PRL+ +TG NE+ D NSKEYKK V++ GLLER+ Sbjct: 282 LCAIICTSAWLCLIPRLKTAKNSGESTGKSDFRNEKPDTNSKEYKKKVIMDGLLERN 338