BLASTX nr result
ID: Zingiber23_contig00033603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00033603 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_020141094.1| hypothetical protein [Streptomyces sp. 351MF... 55 8e-06 >ref|WP_020141094.1| hypothetical protein [Streptomyces sp. 351MFTsu5.1] Length = 264 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/64 (51%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Frame = -2 Query: 197 TGGDESSGTGSHRGSGDGSWGATDDVG--GQGGRGTSGDVGMGGTDAVGAGNRGSDGFTS 24 TGGD S G GS G+GDGS DVG G GG G SG G GGTD GA G+ G Sbjct: 65 TGGDTSGGAGSGGGAGDGS-----DVGDAGSGGAGGSGAGGSGGTDGAGAAGGGAAGSGV 119 Query: 23 GWGN 12 G G+ Sbjct: 120 GQGD 123