BLASTX nr result
ID: Zingiber23_contig00033293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00033293 (286 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314734.1| hypothetical protein POPTR_0010s10650g [Popu... 98 1e-18 ref|XP_006438444.1| hypothetical protein CICLE_v10031899mg [Citr... 97 2e-18 gb|EOY00418.1| Serine/threonine-protein kinase WNK-related [Theo... 96 5e-18 gb|ESW29471.1| hypothetical protein PHAVU_002G072900g [Phaseolus... 95 8e-18 gb|AFK33729.1| unknown [Lotus japonicus] 95 8e-18 ref|XP_003519586.1| PREDICTED: uncharacterized protein LOC100799... 95 8e-18 ref|XP_003517791.1| PREDICTED: uncharacterized protein LOC100816... 95 8e-18 ref|XP_003613278.1| Basic helix-loop-helix protein, putative [Me... 95 8e-18 ref|XP_002521032.1| conserved hypothetical protein [Ricinus comm... 95 8e-18 gb|EXB82633.1| hypothetical protein L484_027814 [Morus notabilis] 95 1e-17 ref|XP_006355965.1| PREDICTED: uncharacterized protein LOC102584... 95 1e-17 ref|XP_004489864.1| PREDICTED: uncharacterized protein LOC101507... 95 1e-17 ref|XP_004298589.1| PREDICTED: uncharacterized protein LOC101307... 95 1e-17 ref|XP_004238686.1| PREDICTED: uncharacterized protein LOC101257... 95 1e-17 gb|EMJ26133.1| hypothetical protein PRUPE_ppa021606mg [Prunus pe... 94 2e-17 ref|XP_002454301.1| hypothetical protein SORBIDRAFT_04g028230 [S... 94 2e-17 gb|ACU19137.1| unknown [Glycine max] 93 3e-17 emb|CBI32118.3| unnamed protein product [Vitis vinifera] 93 4e-17 ref|XP_002265760.1| PREDICTED: uncharacterized protein LOC100258... 93 4e-17 ref|XP_006392188.1| hypothetical protein EUTSA_v10023517mg [Eutr... 91 2e-16 >ref|XP_002314734.1| hypothetical protein POPTR_0010s10650g [Populus trichocarpa] gi|222863774|gb|EEF00905.1| hypothetical protein POPTR_0010s10650g [Populus trichocarpa] Length = 366 Score = 97.8 bits (242), Expect = 1e-18 Identities = 53/93 (56%), Positives = 62/93 (66%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHPXXXXXXXX 182 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 167 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHPSSSAYPYK 226 Query: 183 XXFPIVDGCNMAAAGLHWTXXXXXXXXXXEFYD 281 VDG + H+ EFYD Sbjct: 227 -----VDGYGTVSDTWHYQGSNIAPQSPTEFYD 254 >ref|XP_006438444.1| hypothetical protein CICLE_v10031899mg [Citrus clementina] gi|568860610|ref|XP_006483809.1| PREDICTED: uncharacterized protein LOC102627572 [Citrus sinensis] gi|557540640|gb|ESR51684.1| hypothetical protein CICLE_v10031899mg [Citrus clementina] Length = 364 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+VNKVVEDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVVQLGAVNKVVEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >gb|EOY00418.1| Serine/threonine-protein kinase WNK-related [Theobroma cacao] Length = 357 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 +GIKTIAL+AVREGVVQLG+VNKV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 167 AGIKTIALIAVREGVVQLGAVNKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 218 >gb|ESW29471.1| hypothetical protein PHAVU_002G072900g [Phaseolus vulgaris] Length = 361 Score = 95.1 bits (235), Expect = 8e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >gb|AFK33729.1| unknown [Lotus japonicus] Length = 366 Score = 95.1 bits (235), Expect = 8e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >ref|XP_003519586.1| PREDICTED: uncharacterized protein LOC100799671 [Glycine max] Length = 385 Score = 95.1 bits (235), Expect = 8e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >ref|XP_003517791.1| PREDICTED: uncharacterized protein LOC100816910 [Glycine max] Length = 376 Score = 95.1 bits (235), Expect = 8e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >ref|XP_003613278.1| Basic helix-loop-helix protein, putative [Medicago truncatula] gi|355514613|gb|AES96236.1| Basic helix-loop-helix protein, putative [Medicago truncatula] Length = 362 Score = 95.1 bits (235), Expect = 8e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 170 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 221 >ref|XP_002521032.1| conserved hypothetical protein [Ricinus communis] gi|223539869|gb|EEF41449.1| conserved hypothetical protein [Ricinus communis] Length = 366 Score = 95.1 bits (235), Expect = 8e-18 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 167 SGIKTIALIAVREGVVQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 218 >gb|EXB82633.1| hypothetical protein L484_027814 [Morus notabilis] Length = 411 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/52 (84%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+++KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 197 SGIKTIALIAVREGVVQLGAIHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 248 >ref|XP_006355965.1| PREDICTED: uncharacterized protein LOC102584308 [Solanum tuberosum] Length = 401 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/52 (84%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGV+QLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 169 SGIKTIALIAVREGVIQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 220 >ref|XP_004489864.1| PREDICTED: uncharacterized protein LOC101507460 [Cicer arietinum] Length = 350 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/52 (84%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGV+QLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVIQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >ref|XP_004298589.1| PREDICTED: uncharacterized protein LOC101307490 [Fragaria vesca subsp. vesca] Length = 488 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG++NKVVEDLS++VLLRKK SY+ESIPGVLLPHP Sbjct: 181 SGIKTIALIAVREGVVQLGAINKVVEDLSYVVLLRKKLSYIESIPGVLLPHP 232 >ref|XP_004238686.1| PREDICTED: uncharacterized protein LOC101257467 [Solanum lycopersicum] Length = 402 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/52 (84%), Positives = 52/52 (100%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGV+QLG+V+KV+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 173 SGIKTIALIAVREGVIQLGAVHKVIEDLSYVVLLRKKFSYIESIPGVLLPHP 224 >gb|EMJ26133.1| hypothetical protein PRUPE_ppa021606mg [Prunus persica] Length = 369 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+ +KVVEDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 173 SGIKTIALIAVREGVVQLGATHKVVEDLSYVVLLRKKFSYIESIPGVLLPHP 224 >ref|XP_002454301.1| hypothetical protein SORBIDRAFT_04g028230 [Sorghum bicolor] gi|241934132|gb|EES07277.1| hypothetical protein SORBIDRAFT_04g028230 [Sorghum bicolor] Length = 330 Score = 93.6 bits (231), Expect = 2e-17 Identities = 52/93 (55%), Positives = 58/93 (62%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHPXXXXXXXX 182 SGIKTIAL+AVREGVVQLGS+NKV EDLS++V+LR+KF YLESIPGVLLPHP Sbjct: 142 SGIKTIALIAVREGVVQLGSMNKVAEDLSYVVMLRRKFGYLESIPGVLLPHPSSSAAFPA 201 Query: 183 XXFPIVDGCNMAAAGLHWTXXXXXXXXXXEFYD 281 V G A A W E YD Sbjct: 202 AGCAAVAG-PAADAACSWPPGLVVPPPMMELYD 233 >gb|ACU19137.1| unknown [Glycine max] Length = 385 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/52 (84%), Positives = 51/52 (98%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL+AVREGVVQLG+V+ V+EDLS++VLLRKKFSY+ESIPGVLLPHP Sbjct: 168 SGIKTIALIAVREGVVQLGAVHNVIEDLSYVVLLRKKFSYIESIPGVLLPHP 219 >emb|CBI32118.3| unnamed protein product [Vitis vinifera] Length = 237 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/52 (80%), Positives = 51/52 (98%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SG+KTIAL+AVREGV+QLG+V+KV+EDLS++VLLRKKF Y+ESIPGVLLPHP Sbjct: 168 SGVKTIALIAVREGVIQLGAVHKVIEDLSYVVLLRKKFGYIESIPGVLLPHP 219 >ref|XP_002265760.1| PREDICTED: uncharacterized protein LOC100258629 [Vitis vinifera] Length = 346 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/52 (80%), Positives = 51/52 (98%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SG+KTIAL+AVREGV+QLG+V+KV+EDLS++VLLRKKF Y+ESIPGVLLPHP Sbjct: 168 SGVKTIALIAVREGVIQLGAVHKVIEDLSYVVLLRKKFGYIESIPGVLLPHP 219 >ref|XP_006392188.1| hypothetical protein EUTSA_v10023517mg [Eutrema salsugineum] gi|557088694|gb|ESQ29474.1| hypothetical protein EUTSA_v10023517mg [Eutrema salsugineum] Length = 387 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/52 (80%), Positives = 51/52 (98%) Frame = +3 Query: 3 SGIKTIALVAVREGVVQLGSVNKVVEDLSFIVLLRKKFSYLESIPGVLLPHP 158 SGIKTIAL++VREGVVQLG+V+KV+EDLS++V+LRKK SY+ESIPGVLLPHP Sbjct: 170 SGIKTIALISVREGVVQLGAVHKVIEDLSYVVMLRKKLSYIESIPGVLLPHP 221