BLASTX nr result
ID: Zingiber23_contig00032559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00032559 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273996.2| PREDICTED: uncharacterized protein LOC100250... 58 1e-06 emb|CBI31979.3| unnamed protein product [Vitis vinifera] 58 1e-06 gb|EOY01971.1| Regulator of chromosome condensation (RCC1) famil... 57 3e-06 ref|XP_002980107.1| hypothetical protein SELMODRAFT_112120 [Sela... 55 1e-05 >ref|XP_002273996.2| PREDICTED: uncharacterized protein LOC100250008 [Vitis vinifera] Length = 1047 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 97 MADPLRNGRVERDVEQAITALKKGAYLLKYGR 2 MADP RNG ERDVEQAI ALKKGAYLLKYGR Sbjct: 1 MADPQRNGLAERDVEQAIVALKKGAYLLKYGR 32 >emb|CBI31979.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 97 MADPLRNGRVERDVEQAITALKKGAYLLKYGR 2 MADP RNG ERDVEQAI ALKKGAYLLKYGR Sbjct: 1 MADPQRNGLAERDVEQAIVALKKGAYLLKYGR 32 >gb|EOY01971.1| Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain, putative isoform 1 [Theobroma cacao] gi|508710075|gb|EOY01972.1| Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain, putative isoform 1 [Theobroma cacao] Length = 1022 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 97 MADPLRNGRVERDVEQAITALKKGAYLLKYGR 2 MADP R+G ERD++QAITALKKGAYLLKYGR Sbjct: 1 MADPQRSGLAERDIDQAITALKKGAYLLKYGR 32 >ref|XP_002980107.1| hypothetical protein SELMODRAFT_112120 [Selaginella moellendorffii] gi|300152334|gb|EFJ18977.1| hypothetical protein SELMODRAFT_112120 [Selaginella moellendorffii] Length = 1090 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 97 MADPLRNGRVERDVEQAITALKKGAYLLKYGR 2 MAD RNG VERD+EQAITALKKGA LLKYGR Sbjct: 1 MADLARNGAVERDIEQAITALKKGAQLLKYGR 32