BLASTX nr result
ID: Zingiber23_contig00032555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00032555 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350549.1| PREDICTED: calcineurin B-like protein 7-like... 69 8e-10 ref|XP_006476368.1| PREDICTED: calcineurin B-like protein 7-like... 68 1e-09 ref|XP_006476366.1| PREDICTED: calcineurin B-like protein 7-like... 68 1e-09 ref|XP_006476364.1| PREDICTED: calcineurin B-like protein 7-like... 68 1e-09 ref|XP_006439323.1| hypothetical protein CICLE_v10023916mg [Citr... 68 1e-09 ref|NP_001234705.1| calcium sensor calcineurin B-like [Solanum l... 68 1e-09 ref|XP_006360162.1| PREDICTED: calcineurin B-like protein 4-like... 67 3e-09 gb|EOY25057.1| Calcium-binding EF-hand family protein [Theobroma... 67 3e-09 ref|XP_002516680.1| calcineurin B, putative [Ricinus communis] g... 67 3e-09 ref|NP_001267993.1| uncharacterized protein LOC100246874 [Vitis ... 66 4e-09 ref|XP_002318422.1| hypothetical protein POPTR_0012s02230g [Popu... 66 4e-09 ref|XP_004240957.1| PREDICTED: calcineurin B-like protein 4-like... 65 7e-09 ref|XP_006493311.1| PREDICTED: calcineurin B-like protein 7-like... 65 9e-09 ref|XP_006493309.1| PREDICTED: calcineurin B-like protein 7-like... 65 9e-09 ref|XP_006441085.1| hypothetical protein CICLE_v10022148mg [Citr... 65 9e-09 ref|XP_006441084.1| hypothetical protein CICLE_v10022148mg [Citr... 65 9e-09 ref|XP_002509979.1| calcineurin B, putative [Ricinus communis] g... 65 9e-09 ref|XP_002297970.1| hypothetical protein POPTR_0001s10750g [Popu... 65 9e-09 ref|XP_002321407.1| hypothetical protein POPTR_0015s01540g [Popu... 65 9e-09 ref|XP_006578906.1| PREDICTED: calcineurin B-like protein 4-like... 65 1e-08 >ref|XP_006350549.1| PREDICTED: calcineurin B-like protein 7-like isoform X1 [Solanum tuberosum] gi|565367814|ref|XP_006350550.1| PREDICTED: calcineurin B-like protein 7-like isoform X2 [Solanum tuberosum] gi|565367816|ref|XP_006350551.1| PREDICTED: calcineurin B-like protein 7-like isoform X3 [Solanum tuberosum] gi|565367818|ref|XP_006350552.1| PREDICTED: calcineurin B-like protein 7-like isoform X4 [Solanum tuberosum] Length = 214 Score = 68.6 bits (166), Expect = 8e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS+NPSLLKNMTLPYL D+T +FPSFVM +++ D++ Sbjct: 172 EEWKEFVSKNPSLLKNMTLPYLKDITLAFPSFVMNSEVEDSE 213 >ref|XP_006476368.1| PREDICTED: calcineurin B-like protein 7-like isoform X5 [Citrus sinensis] Length = 216 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EWK+FV++NPSLLKNMT+PYL D+TT+FPSFV++ D+ D Sbjct: 175 EEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIED 214 >ref|XP_006476366.1| PREDICTED: calcineurin B-like protein 7-like isoform X3 [Citrus sinensis] Length = 209 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EWK+FV++NPSLLKNMT+PYL D+TT+FPSFV++ D+ D Sbjct: 168 EEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIED 207 >ref|XP_006476364.1| PREDICTED: calcineurin B-like protein 7-like isoform X1 [Citrus sinensis] Length = 218 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EWK+FV++NPSLLKNMT+PYL D+TT+FPSFV++ D+ D Sbjct: 177 EEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIED 216 >ref|XP_006439323.1| hypothetical protein CICLE_v10023916mg [Citrus clementina] gi|557541585|gb|ESR52563.1| hypothetical protein CICLE_v10023916mg [Citrus clementina] Length = 108 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EWK+FV++NPSLLKNMT+PYL D+TT+FPSFV++ D+ D Sbjct: 63 EEWKEFVARNPSLLKNMTIPYLKDITTAFPSFVLRPDIED 102 >ref|NP_001234705.1| calcium sensor calcineurin B-like [Solanum lycopersicum] gi|66765939|emb|CAG30525.1| calcium sensor calcineurin B-like protein [Solanum lycopersicum] gi|353523400|dbj|BAL04560.1| calcineurin B-like molecule [Solanum lycopersicum] Length = 214 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS NPSLLKNMTLPYL D+T +FPSFVM +++ D++ Sbjct: 172 EEWKEFVSMNPSLLKNMTLPYLKDITLAFPSFVMNSEVEDSE 213 >ref|XP_006360162.1| PREDICTED: calcineurin B-like protein 4-like [Solanum tuberosum] Length = 214 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/42 (64%), Positives = 38/42 (90%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS+NPSLLKNMTLPYL D+T +FPSFV+ +++ D++ Sbjct: 172 EEWKEFVSKNPSLLKNMTLPYLMDITLAFPSFVVSSEVDDSE 213 >gb|EOY25057.1| Calcium-binding EF-hand family protein [Theobroma cacao] Length = 219 Score = 66.6 bits (161), Expect = 3e-09 Identities = 25/40 (62%), Positives = 38/40 (95%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EWK+FV++NP++LKNMT+PYL D+TT+FPSFV+++D+ D Sbjct: 168 EEWKEFVARNPTMLKNMTVPYLKDMTTAFPSFVLRSDIED 207 >ref|XP_002516680.1| calcineurin B, putative [Ricinus communis] gi|223544175|gb|EEF45699.1| calcineurin B, putative [Ricinus communis] Length = 218 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/42 (61%), Positives = 39/42 (92%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS+NPSLL+NMTLPYL D+T +FPSFV+++++ D++ Sbjct: 176 EEWKEFVSKNPSLLRNMTLPYLKDITMAFPSFVLRSEVEDSE 217 >ref|NP_001267993.1| uncharacterized protein LOC100246874 [Vitis vinifera] gi|147835768|emb|CAN75197.1| hypothetical protein VITISV_002738 [Vitis vinifera] gi|229609885|gb|ACQ83558.1| calcineurin B-like protein 04 [Vitis vinifera] gi|302143903|emb|CBI23008.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/42 (61%), Positives = 38/42 (90%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS+NPSL+KNMTLPYL D+T +FPSFV+ +++ D++ Sbjct: 171 EEWKEFVSKNPSLIKNMTLPYLKDITLAFPSFVISSEVEDSE 212 >ref|XP_002318422.1| hypothetical protein POPTR_0012s02230g [Populus trichocarpa] gi|133925821|gb|ABO43663.1| calcineurin B-like protein 4-1 [Populus trichocarpa] gi|222859095|gb|EEE96642.1| hypothetical protein POPTR_0012s02230g [Populus trichocarpa] Length = 213 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/42 (61%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS+NPSL+KNMTLPYL D+T +FPSFV+ ++ D++ Sbjct: 171 EEWKEFVSKNPSLIKNMTLPYLKDITLAFPSFVLSTEVEDSE 212 >ref|XP_004240957.1| PREDICTED: calcineurin B-like protein 4-like [Solanum lycopersicum] Length = 214 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/42 (61%), Positives = 38/42 (90%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FVS+NPSLLKNMTLPYL D+T +FP+FV+ +++ D++ Sbjct: 172 EEWKEFVSRNPSLLKNMTLPYLMDITLAFPNFVVSSEVDDSE 213 >ref|XP_006493311.1| PREDICTED: calcineurin B-like protein 7-like isoform X3 [Citrus sinensis] gi|568880835|ref|XP_006493312.1| PREDICTED: calcineurin B-like protein 7-like isoform X4 [Citrus sinensis] Length = 213 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FV +NPSL+KNMTLPYL D+T +FPSFV+ +++ D++ Sbjct: 171 EEWKEFVKKNPSLIKNMTLPYLKDITLAFPSFVLSSEVEDSE 212 >ref|XP_006493309.1| PREDICTED: calcineurin B-like protein 7-like isoform X1 [Citrus sinensis] gi|568880831|ref|XP_006493310.1| PREDICTED: calcineurin B-like protein 7-like isoform X2 [Citrus sinensis] Length = 220 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FV +NPSL+KNMTLPYL D+T +FPSFV+ +++ D++ Sbjct: 178 EEWKEFVKKNPSLIKNMTLPYLKDITLAFPSFVLSSEVEDSE 219 >ref|XP_006441085.1| hypothetical protein CICLE_v10022148mg [Citrus clementina] gi|557543347|gb|ESR54325.1| hypothetical protein CICLE_v10022148mg [Citrus clementina] Length = 220 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FV +NPSL+KNMTLPYL D+T +FPSFV+ +++ D++ Sbjct: 178 EEWKEFVKKNPSLIKNMTLPYLKDITLAFPSFVLSSEVEDSE 219 >ref|XP_006441084.1| hypothetical protein CICLE_v10022148mg [Citrus clementina] gi|557543346|gb|ESR54324.1| hypothetical protein CICLE_v10022148mg [Citrus clementina] Length = 213 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 +EWK+FV +NPSL+KNMTLPYL D+T +FPSFV+ +++ D++ Sbjct: 171 EEWKEFVKKNPSLIKNMTLPYLKDITLAFPSFVLSSEVEDSE 212 >ref|XP_002509979.1| calcineurin B, putative [Ricinus communis] gi|223549878|gb|EEF51366.1| calcineurin B, putative [Ricinus communis] Length = 210 Score = 65.1 bits (157), Expect = 9e-09 Identities = 25/40 (62%), Positives = 37/40 (92%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EW +FV++NPSLLKNMT+PYL D+TT+FPSFV+++++ D Sbjct: 168 EEWSEFVTRNPSLLKNMTIPYLKDITTAFPSFVLRSEVED 207 >ref|XP_002297970.1| hypothetical protein POPTR_0001s10750g [Populus trichocarpa] gi|222845228|gb|EEE82775.1| hypothetical protein POPTR_0001s10750g [Populus trichocarpa] Length = 216 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSD 120 +EWKDFV++NPSLLKNMTLPYL +LT +FPSFV+ ++ D Sbjct: 175 EEWKDFVTKNPSLLKNMTLPYLKELTLAFPSFVLNTEVPD 214 >ref|XP_002321407.1| hypothetical protein POPTR_0015s01540g [Populus trichocarpa] gi|133925823|gb|ABO43664.1| calcineurin B-like protein 4-2 [Populus trichocarpa] gi|222868403|gb|EEF05534.1| hypothetical protein POPTR_0015s01540g [Populus trichocarpa] Length = 213 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/42 (61%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 DEWK+FVS+NPSL+KNMTLP+L D+T +FPSFV + ++ D++ Sbjct: 171 DEWKEFVSKNPSLIKNMTLPHLKDITLAFPSFVSKTEVEDSE 212 >ref|XP_006578906.1| PREDICTED: calcineurin B-like protein 4-like isoform X2 [Glycine max] gi|571451986|ref|XP_006578907.1| PREDICTED: calcineurin B-like protein 4-like isoform X3 [Glycine max] Length = 223 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/42 (61%), Positives = 37/42 (88%) Frame = +1 Query: 1 DEWKDFVSQNPSLLKNMTLPYLSDLTTSFPSFVMQADLSDTD 126 DEWK FVS++PSL+KNMTLPYL D+T +FPSFV++ D+ +++ Sbjct: 181 DEWKAFVSKHPSLIKNMTLPYLKDITLAFPSFVIRTDIEESE 222