BLASTX nr result
ID: Zingiber23_contig00031836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00031836 (547 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001143146.1| hypothetical protein [Zea mays] gi|195615030... 60 3e-07 ref|XP_004981114.1| PREDICTED: uncharacterized protein LOC101777... 60 4e-07 >ref|NP_001143146.1| hypothetical protein [Zea mays] gi|195615030|gb|ACG29345.1| hypothetical protein [Zea mays] gi|414873845|tpg|DAA52402.1| TPA: hypothetical protein ZEAMMB73_212253 [Zea mays] Length = 118 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/46 (56%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = -1 Query: 541 MEVDDSFKRPGSIPFKWEVQPGVPKQKNIIG----PDSPQKLCLPP 416 M +D+SFKRPG++PFKWEVQPG+PKQ+ G P + +L LPP Sbjct: 1 MTLDESFKRPGTVPFKWEVQPGIPKQQGAAGDVPPPPTSPRLALPP 46 >ref|XP_004981114.1| PREDICTED: uncharacterized protein LOC101777976 [Setaria italica] Length = 140 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 17/65 (26%) Frame = -1 Query: 541 MEVDDSFKRPGSIPFKWEVQPGVPKQKNI---------------IGPDSPQKLCLPPV-- 413 M VD+SFKRPGSIPFKWEVQPG+PKQ+ + + P +P KL LPP Sbjct: 1 MAVDESFKRPGSIPFKWEVQPGIPKQEELPPAAAGDSTAVPAPGLPPTTP-KLALPPAAR 59 Query: 412 LCAIS 398 +CA++ Sbjct: 60 VCALA 64