BLASTX nr result
ID: Zingiber23_contig00031750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00031750 (721 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518622.2| PREDICTED: uncharacterized protein LOC100813... 60 7e-07 ref|XP_003535180.1| PREDICTED: uncharacterized protein LOC100784... 60 7e-07 gb|ESW17444.1| hypothetical protein PHAVU_007G240300g [Phaseolus... 59 1e-06 ref|XP_004169902.1| PREDICTED: uncharacterized protein LOC101231... 59 1e-06 ref|XP_004143691.1| PREDICTED: uncharacterized protein LOC101204... 59 1e-06 ref|XP_006340456.1| PREDICTED: dentin sialophosphoprotein-like [... 59 2e-06 ref|XP_002315275.2| dentin sialophosphoprotein [Populus trichoca... 59 2e-06 ref|XP_004237664.1| PREDICTED: uncharacterized protein LOC101249... 59 2e-06 ref|XP_004514381.1| PREDICTED: uncharacterized protein LOC101505... 57 5e-06 ref|XP_002275488.2| PREDICTED: uncharacterized protein LOC100266... 57 5e-06 emb|CBI31518.3| unnamed protein product [Vitis vinifera] 57 5e-06 emb|CAN75603.1| hypothetical protein VITISV_016382 [Vitis vinifera] 57 5e-06 ref|XP_006485937.1| PREDICTED: uncharacterized protein LOC102624... 57 6e-06 ref|XP_006485936.1| PREDICTED: uncharacterized protein LOC102624... 57 6e-06 ref|XP_006485935.1| PREDICTED: uncharacterized protein LOC102624... 57 6e-06 ref|XP_006436204.1| hypothetical protein CICLE_v10030525mg [Citr... 57 6e-06 ref|XP_006436203.1| hypothetical protein CICLE_v10030525mg [Citr... 57 6e-06 ref|XP_002523905.1| hypothetical protein RCOM_1068550 [Ricinus c... 57 6e-06 >ref|XP_003518622.2| PREDICTED: uncharacterized protein LOC100813734 [Glycine max] Length = 1015 Score = 60.1 bits (144), Expect = 7e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 119 RYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 RYL P + E + F++SD+VWGKVRSHPWWPG IF PS Sbjct: 356 RYLLPIEKEGE--FSVSDMVWGKVRSHPWWPGQIFDPS 391 >ref|XP_003535180.1| PREDICTED: uncharacterized protein LOC100784689 isoform X1 [Glycine max] gi|571482663|ref|XP_006589021.1| PREDICTED: uncharacterized protein LOC100784689 isoform X2 [Glycine max] Length = 1019 Score = 60.1 bits (144), Expect = 7e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 119 RYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 RYL P + E + F++SD+VWGKVRSHPWWPG IF PS Sbjct: 356 RYLLPIEKEGE--FSVSDMVWGKVRSHPWWPGQIFDPS 391 >gb|ESW17444.1| hypothetical protein PHAVU_007G240300g [Phaseolus vulgaris] Length = 1139 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 119 RYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 RYL P + E+ +FA+S++VWGKVRSHPWWPG IF PS Sbjct: 477 RYLLPTEKES--NFAVSNMVWGKVRSHPWWPGQIFNPS 512 >ref|XP_004169902.1| PREDICTED: uncharacterized protein LOC101231715 [Cucumis sativus] Length = 815 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 95 ENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 EN+ F++SDLVWGKVRSHPWWPG IF PS Sbjct: 548 ENEGDFSVSDLVWGKVRSHPWWPGQIFDPS 577 >ref|XP_004143691.1| PREDICTED: uncharacterized protein LOC101204371 [Cucumis sativus] Length = 1936 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 95 ENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 EN+ F++SDLVWGKVRSHPWWPG IF PS Sbjct: 548 ENEGDFSVSDLVWGKVRSHPWWPGQIFDPS 577 >ref|XP_006340456.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum] Length = 1656 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 116 YLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 YL P EN+ ++ISDLVWGKVRSHPWWPG IF PS Sbjct: 1047 YLIP--PENEGEYSISDLVWGKVRSHPWWPGQIFDPS 1081 >ref|XP_002315275.2| dentin sialophosphoprotein [Populus trichocarpa] gi|550330363|gb|EEF01446.2| dentin sialophosphoprotein [Populus trichocarpa] Length = 1404 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 116 YLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 YL P +N+ F++SDLVWGKVRSHPWWPG IF PS Sbjct: 780 YLLP--PDNEGEFSVSDLVWGKVRSHPWWPGQIFDPS 814 >ref|XP_004237664.1| PREDICTED: uncharacterized protein LOC101249817 [Solanum lycopersicum] Length = 1654 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 116 YLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 YL P EN+ ++ISDLVWGKVRSHPWWPG IF PS Sbjct: 1046 YLIP--PENEGDYSISDLVWGKVRSHPWWPGQIFDPS 1080 >ref|XP_004514381.1| PREDICTED: uncharacterized protein LOC101505515 isoform X1 [Cicer arietinum] gi|502168412|ref|XP_004514382.1| PREDICTED: uncharacterized protein LOC101505515 isoform X2 [Cicer arietinum] Length = 1080 Score = 57.4 bits (137), Expect = 5e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 119 RYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 RYL P E + F++SD+VWGKVRSHPWWPG IF PS Sbjct: 427 RYLLPTVKEEGE-FSLSDMVWGKVRSHPWWPGQIFDPS 463 >ref|XP_002275488.2| PREDICTED: uncharacterized protein LOC100266828 [Vitis vinifera] Length = 2271 Score = 57.4 bits (137), Expect = 5e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 95 ENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 E++ F++SDLVWGKVRSHPWWPG IF PS Sbjct: 1957 ESEGEFSVSDLVWGKVRSHPWWPGQIFDPS 1986 >emb|CBI31518.3| unnamed protein product [Vitis vinifera] Length = 1275 Score = 57.4 bits (137), Expect = 5e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 95 ENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 E++ F++SDLVWGKVRSHPWWPG IF PS Sbjct: 886 ESEGEFSVSDLVWGKVRSHPWWPGQIFDPS 915 >emb|CAN75603.1| hypothetical protein VITISV_016382 [Vitis vinifera] Length = 1887 Score = 57.4 bits (137), Expect = 5e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 95 ENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 E++ F++SDLVWGKVRSHPWWPG IF PS Sbjct: 1249 ESEGEFSVSDLVWGKVRSHPWWPGQIFDPS 1278 >ref|XP_006485937.1| PREDICTED: uncharacterized protein LOC102624524 isoform X3 [Citrus sinensis] Length = 1372 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 122 VRYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 V L P +DE + F +SDLVWGKVRSHPWWPG I+ PS Sbjct: 741 VSCLLPLEDEGE--FFVSDLVWGKVRSHPWWPGQIYDPS 777 >ref|XP_006485936.1| PREDICTED: uncharacterized protein LOC102624524 isoform X2 [Citrus sinensis] Length = 1390 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 122 VRYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 V L P +DE + F +SDLVWGKVRSHPWWPG I+ PS Sbjct: 759 VSCLLPLEDEGE--FFVSDLVWGKVRSHPWWPGQIYDPS 795 >ref|XP_006485935.1| PREDICTED: uncharacterized protein LOC102624524 isoform X1 [Citrus sinensis] Length = 1409 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 122 VRYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 V L P +DE + F +SDLVWGKVRSHPWWPG I+ PS Sbjct: 778 VSCLLPLEDEGE--FFVSDLVWGKVRSHPWWPGQIYDPS 814 >ref|XP_006436204.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] gi|567887366|ref|XP_006436205.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] gi|557538400|gb|ESR49444.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] gi|557538401|gb|ESR49445.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] Length = 1409 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 122 VRYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 V L P +DE + F +SDLVWGKVRSHPWWPG I+ PS Sbjct: 778 VSCLLPLEDEGE--FFVSDLVWGKVRSHPWWPGQIYDPS 814 >ref|XP_006436203.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] gi|567887368|ref|XP_006436206.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] gi|557538399|gb|ESR49443.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] gi|557538402|gb|ESR49446.1| hypothetical protein CICLE_v10030525mg [Citrus clementina] Length = 1372 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 122 VRYLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 V L P +DE + F +SDLVWGKVRSHPWWPG I+ PS Sbjct: 741 VSCLLPLEDEGE--FFVSDLVWGKVRSHPWWPGQIYDPS 777 >ref|XP_002523905.1| hypothetical protein RCOM_1068550 [Ricinus communis] gi|223536835|gb|EEF38474.1| hypothetical protein RCOM_1068550 [Ricinus communis] Length = 1557 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -3 Query: 116 YLQPFQDENKDSFAISDLVWGKVRSHPWWPGWIFGPS 6 Y P DE + F++SDLVWGKVRSHPWWPG IF PS Sbjct: 926 YQLPPDDEGE--FSVSDLVWGKVRSHPWWPGQIFDPS 960