BLASTX nr result
ID: Zingiber23_contig00031594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00031594 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848151.1| hypothetical protein AMTR_s00029p00229910 [A... 45 6e-06 >ref|XP_006848151.1| hypothetical protein AMTR_s00029p00229910 [Amborella trichopoda] gi|548851456|gb|ERN09732.1| hypothetical protein AMTR_s00029p00229910 [Amborella trichopoda] Length = 565 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -2 Query: 207 LSRYASSQWTARSDLTAAEETFLEAIEAGPLEHRRRGH 94 LSRYA W R+D+ AAEETFLEAIEA P G+ Sbjct: 507 LSRYAHFLWRVRNDIAAAEETFLEAIEADPGNSHHAGN 544 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 119 LWSTVGEDTCYPL 81 LW+T GEDTCYPL Sbjct: 549 LWNTGGEDTCYPL 561