BLASTX nr result
ID: Zingiber23_contig00030883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00030883 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553495.1| PREDICTED: ethylene-responsive transcription... 55 1e-05 >ref|XP_003553495.1| PREDICTED: ethylene-responsive transcription factor 1B-like [Glycine max] Length = 253 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = +1 Query: 1 VVALKRKHSARRKSSVDKKEKVAEXXXXXXXXXXXXVLEFEDLGAEYLEELLWSTS 168 V+ALKRKH+ RRKS+ KK K+ + VL FEDLGAEYLE+LL TS Sbjct: 198 VLALKRKHTMRRKSNSKKKSKIDQREQLDFSSSSQNVLVFEDLGAEYLEQLLSLTS 253