BLASTX nr result
ID: Zingiber23_contig00030622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00030622 (207 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA52992.1| TPA: hypothetical protein ZEAMMB73_513383 [Zea m... 57 3e-06 ref|XP_004146819.1| PREDICTED: zinc finger protein MAGPIE-like [... 55 7e-06 >tpg|DAA52992.1| TPA: hypothetical protein ZEAMMB73_513383 [Zea mays] Length = 497 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = +3 Query: 36 HQYPLKHQALEENMSNLTSPSGEACSVSSNQHYSSLASSTIPNSTKKKRSLPGNPDP 206 HQ L A +ENMSNLTS SG+ SVSS+ +P KKKRSLPGNPDP Sbjct: 14 HQQQLAAAAADENMSNLTSASGDQASVSSHP---------VPPPAKKKRSLPGNPDP 61 >ref|XP_004146819.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis sativus] Length = 527 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 6/56 (10%) Frame = +3 Query: 57 QALEENMSNLTSPSGEACSVSSNQ------HYSSLASSTIPNSTKKKRSLPGNPDP 206 QA+EEN+SNLTS SGEA + S N +YS ST P KKKR+LPGNPDP Sbjct: 12 QAMEENLSNLTSASGEASACSGNHSDQIPTNYSGQFFST-PPPPKKKRNLPGNPDP 66