BLASTX nr result
ID: Zingiber23_contig00030600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00030600 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC13945.1| hypothetical protein L484_006643 [Morus notabilis] 80 3e-13 ref|XP_002889076.1| integral membrane family protein [Arabidopsi... 79 5e-13 ref|XP_006416380.1| hypothetical protein EUTSA_v10009949mg [Eutr... 79 6e-13 ref|XP_006390208.1| hypothetical protein EUTSA_v10018733mg [Eutr... 79 6e-13 ref|NP_177760.1| golgi nucleotide sugar transporter 3 [Arabidops... 79 8e-13 ref|XP_006302419.1| hypothetical protein CARUB_v10020492mg [Caps... 78 1e-12 ref|XP_006830393.1| hypothetical protein AMTR_s00116p00145580 [A... 77 2e-12 gb|EMJ17688.1| hypothetical protein PRUPE_ppa025074mg [Prunus pe... 77 3e-12 ref|XP_004139859.1| PREDICTED: GDP-mannose transporter GONST3-li... 77 3e-12 gb|EOY16316.1| Golgi nucleotide sugar transporter 3 isoform 1 [T... 76 5e-12 ref|XP_004300114.1| PREDICTED: GDP-mannose transporter GONST3-li... 76 5e-12 gb|ACD56609.1| putative integral membrane protein [Gossypioides ... 76 5e-12 gb|ABO41839.1| putative integral membrane protein [Gossypium arb... 76 5e-12 gb|ABO41833.1| putative integral membrane protein [Gossypium rai... 76 5e-12 ref|XP_002311722.2| integral membrane family protein [Populus tr... 75 7e-12 ref|XP_002314544.1| hypothetical protein POPTR_0010s06770g [Popu... 75 7e-12 gb|EMJ10334.1| hypothetical protein PRUPE_ppa005696mg [Prunus pe... 75 9e-12 ref|XP_006649634.1| PREDICTED: GDP-mannose transporter GONST3-li... 74 2e-11 ref|XP_006649633.1| PREDICTED: GDP-mannose transporter GONST3-li... 74 2e-11 ref|XP_006490127.1| PREDICTED: GDP-mannose transporter GONST3-li... 74 2e-11 >gb|EXC13945.1| hypothetical protein L484_006643 [Morus notabilis] Length = 373 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTTXXXXXXXXXXXXXXPGDDE 175 VNKLLTVVINLV+WD HSTF GTLGLL+CMFGGV+YQQST+ ++E Sbjct: 291 VNKLLTVVINLVIWDKHSTFIGTLGLLICMFGGVMYQQSTSNKPKATQEVKAQPQENEEE 350 Query: 174 EQR 166 +Q+ Sbjct: 351 QQK 353 >ref|XP_002889076.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata] gi|297334917|gb|EFH65335.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata] Length = 372 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQST 235 VNKLLTVVINLVVWD HSTF GTLGLL+CMFGGV+YQQST Sbjct: 287 VNKLLTVVINLVVWDKHSTFVGTLGLLICMFGGVMYQQST 326 >ref|XP_006416380.1| hypothetical protein EUTSA_v10009949mg [Eutrema salsugineum] gi|557094151|gb|ESQ34733.1| hypothetical protein EUTSA_v10009949mg [Eutrema salsugineum] Length = 361 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GTLGLL+CMFGGV+YQQST+ Sbjct: 290 VNKLLTVVINLVIWDKHSTFIGTLGLLICMFGGVMYQQSTS 330 >ref|XP_006390208.1| hypothetical protein EUTSA_v10018733mg [Eutrema salsugineum] gi|567120730|ref|XP_006390209.1| hypothetical protein EUTSA_v10018733mg [Eutrema salsugineum] gi|557086642|gb|ESQ27494.1| hypothetical protein EUTSA_v10018733mg [Eutrema salsugineum] gi|557086643|gb|ESQ27495.1| hypothetical protein EUTSA_v10018733mg [Eutrema salsugineum] Length = 371 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQST 235 VNKLLTVVINL+VWD HSTF GTLGLL+CMFGGV+YQQST Sbjct: 286 VNKLLTVVINLIVWDKHSTFVGTLGLLICMFGGVMYQQST 325 >ref|NP_177760.1| golgi nucleotide sugar transporter 3 [Arabidopsis thaliana] gi|75198562|sp|Q9S845.1|GONS3_ARATH RecName: Full=GDP-mannose transporter GONST3; AltName: Full=Protein GOLGI NUCLEOTIDE SUGAR TRANSPORTER 3 gi|6554485|gb|AAF16667.1|AC012394_16 unknown protein; 69155-70273 [Arabidopsis thaliana] gi|6573714|gb|AAF17634.1|AC009978_10 T23E18.26 [Arabidopsis thaliana] gi|29329821|emb|CAD83087.1| GONST3 Golgi Nucleotide sugar transporter [Arabidopsis thaliana] gi|332197705|gb|AEE35826.1| golgi nucleotide sugar transporter 3 [Arabidopsis thaliana] Length = 372 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQST 235 VNKLLTVVINL+VWD HSTF GTLGLLVCMFGGV+YQQST Sbjct: 287 VNKLLTVVINLMVWDKHSTFVGTLGLLVCMFGGVMYQQST 326 >ref|XP_006302419.1| hypothetical protein CARUB_v10020492mg [Capsella rubella] gi|482571129|gb|EOA35317.1| hypothetical protein CARUB_v10020492mg [Capsella rubella] Length = 371 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQST 235 VNKLLTVVINL+VWD HSTF GTLGLL+CMFGGV+YQQST Sbjct: 286 VNKLLTVVINLMVWDKHSTFVGTLGLLICMFGGVMYQQST 325 >ref|XP_006830393.1| hypothetical protein AMTR_s00116p00145580 [Amborella trichopoda] gi|548836663|gb|ERM97809.1| hypothetical protein AMTR_s00116p00145580 [Amborella trichopoda] Length = 375 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINL++WD HSTF GT GLL+CMFGGVLYQQST+ Sbjct: 292 VNKLLTVVINLMIWDKHSTFIGTFGLLICMFGGVLYQQSTS 332 >gb|EMJ17688.1| hypothetical protein PRUPE_ppa025074mg [Prunus persica] Length = 381 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GTLGLL+CM GGV+YQQST+ Sbjct: 297 VNKLLTVVINLVIWDKHSTFVGTLGLLICMVGGVMYQQSTS 337 >ref|XP_004139859.1| PREDICTED: GDP-mannose transporter GONST3-like [Cucumis sativus] gi|449521993|ref|XP_004168013.1| PREDICTED: GDP-mannose transporter GONST3-like [Cucumis sativus] Length = 378 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/63 (57%), Positives = 44/63 (69%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTTXXXXXXXXXXXXXXPGDDE 175 VNKLLTVVINLV+WD HSTF GT+GLL+CM GG+LYQQST+ D+E Sbjct: 294 VNKLLTVVINLVIWDKHSTFIGTVGLLICMSGGILYQQSTSSKPKAATKEVRVEEAVDEE 353 Query: 174 EQR 166 +Q+ Sbjct: 354 QQK 356 >gb|EOY16316.1| Golgi nucleotide sugar transporter 3 isoform 1 [Theobroma cacao] gi|508724420|gb|EOY16317.1| Golgi nucleotide sugar transporter 3 isoform 1 [Theobroma cacao] Length = 371 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GGV+YQQST+ Sbjct: 288 VNKLLTVVINLVIWDKHSTFVGTVGLLICMIGGVMYQQSTS 328 >ref|XP_004300114.1| PREDICTED: GDP-mannose transporter GONST3-like [Fragaria vesca subsp. vesca] Length = 519 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GGV+YQQST+ Sbjct: 430 VNKLLTVVINLVIWDKHSTFVGTVGLLICMLGGVMYQQSTS 470 >gb|ACD56609.1| putative integral membrane protein [Gossypioides kirkii] Length = 371 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GGV+YQQST+ Sbjct: 288 VNKLLTVVINLVIWDKHSTFVGTVGLLICMLGGVMYQQSTS 328 >gb|ABO41839.1| putative integral membrane protein [Gossypium arboreum] gi|133902315|gb|ABO41844.1| putative integral membrane protein [Gossypium hirsutum] Length = 369 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GGV+YQQST+ Sbjct: 288 VNKLLTVVINLVIWDKHSTFVGTVGLLICMLGGVMYQQSTS 328 >gb|ABO41833.1| putative integral membrane protein [Gossypium raimondii] Length = 369 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GGV+YQQST+ Sbjct: 288 VNKLLTVVINLVIWDKHSTFVGTVGLLICMLGGVMYQQSTS 328 >ref|XP_002311722.2| integral membrane family protein [Populus trichocarpa] gi|550333324|gb|EEE89089.2| integral membrane family protein [Populus trichocarpa] Length = 372 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLVVWD HSTF GT+GLL+CM GG++YQQST+ Sbjct: 293 VNKLLTVVINLVVWDKHSTFIGTVGLLICMLGGIMYQQSTS 333 >ref|XP_002314544.1| hypothetical protein POPTR_0010s06770g [Populus trichocarpa] gi|222863584|gb|EEF00715.1| hypothetical protein POPTR_0010s06770g [Populus trichocarpa] Length = 371 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GG++YQQST+ Sbjct: 292 VNKLLTVVINLVIWDKHSTFVGTVGLLICMLGGIMYQQSTS 332 >gb|EMJ10334.1| hypothetical protein PRUPE_ppa005696mg [Prunus persica] Length = 447 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HSTF GT+GLL+CM GGV+YQQST+ Sbjct: 363 VNKLLTVVINLVIWDKHSTFVGTVGLLICMAGGVMYQQSTS 403 >ref|XP_006649634.1| PREDICTED: GDP-mannose transporter GONST3-like isoform X2 [Oryza brachyantha] Length = 369 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINL++WD H++F GT+GLL+CM GGVLYQQSTT Sbjct: 291 VNKLLTVVINLLIWDKHASFVGTIGLLICMSGGVLYQQSTT 331 >ref|XP_006649633.1| PREDICTED: GDP-mannose transporter GONST3-like isoform X1 [Oryza brachyantha] Length = 379 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINL++WD H++F GT+GLL+CM GGVLYQQSTT Sbjct: 301 VNKLLTVVINLLIWDKHASFVGTIGLLICMSGGVLYQQSTT 341 >ref|XP_006490127.1| PREDICTED: GDP-mannose transporter GONST3-like [Citrus sinensis] Length = 372 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 354 VNKLLTVVINLVVWDNHSTFAGTLGLLVCMFGGVLYQQSTT 232 VNKLLTVVINLV+WD HST+ GT+GLL+CM GGV+YQQST+ Sbjct: 292 VNKLLTVVINLVIWDKHSTWVGTVGLLICMLGGVMYQQSTS 332