BLASTX nr result
ID: Zingiber23_contig00029641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00029641 (398 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60100.1| hypothetical protein VITISV_021668 [Vitis vinifera] 58 1e-06 emb|CAN78145.1| hypothetical protein VITISV_039877 [Vitis vinifera] 57 3e-06 emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] 55 7e-06 >emb|CAN60100.1| hypothetical protein VITISV_021668 [Vitis vinifera] Length = 411 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 113 LHVTFITKNLLSVRQFALDNNVFFEFHPHYCLVK 12 LHV ITKNLLSV +F DNNVFFEFHP++CLVK Sbjct: 306 LHVLXITKNLLSVSKFXRDNNVFFEFHPNFCLVK 339 >emb|CAN78145.1| hypothetical protein VITISV_039877 [Vitis vinifera] Length = 410 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 113 LHVTFITKNLLSVRQFALDNNVFFEFHPHYCLVKDLT 3 LHV ITKNLLSV +FA DN+VFFEFH H C VKD T Sbjct: 284 LHVPTITKNLLSVSKFAHDNDVFFEFHSHSCFVKDQT 320 >emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] Length = 1424 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 113 LHVTFITKNLLSVRQFALDNNVFFEFHPHYCLVKD 9 LHV ITKNLLSV +FA DN+VFFEFHP C VKD Sbjct: 416 LHVPEITKNLLSVSKFAADNHVFFEFHPTSCFVKD 450