BLASTX nr result
ID: Zingiber23_contig00029584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00029584 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003562613.1| PREDICTED: uncharacterized protein C24B11.05... 55 7e-06 gb|ESW35254.1| hypothetical protein PHAVU_001G219300g [Phaseolus... 55 1e-05 >ref|XP_003562613.1| PREDICTED: uncharacterized protein C24B11.05-like [Brachypodium distachyon] Length = 254 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 100 MATITKEAKYDCLVFDMDDTLYPLTSGLNLACR 2 M + EAK+DCL+FDMDDTLYPL+ G+NLACR Sbjct: 1 MESYNSEAKFDCLLFDMDDTLYPLSLGINLACR 33 >gb|ESW35254.1| hypothetical protein PHAVU_001G219300g [Phaseolus vulgaris] Length = 280 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 76 KYDCLVFDMDDTLYPLTSGLNLACR 2 KYDCL+FDMDDTLYPL+SGLNLACR Sbjct: 11 KYDCLLFDMDDTLYPLSSGLNLACR 35