BLASTX nr result
ID: Zingiber23_contig00029579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00029579 (207 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276691.1| PREDICTED: putative RNA-binding protein Luc7... 56 4e-06 emb|CAN71034.1| hypothetical protein VITISV_000356 [Vitis vinifera] 56 4e-06 >ref|XP_002276691.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Vitis vinifera] gi|297735244|emb|CBI17606.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 205 YMQIREKLAELQEERNRKRKVDRTEDDTRSKE 110 YMQIREKLAELQEERN+ RKVDR E+D RSKE Sbjct: 300 YMQIREKLAELQEERNKSRKVDRHENDRRSKE 331 >emb|CAN71034.1| hypothetical protein VITISV_000356 [Vitis vinifera] Length = 419 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 205 YMQIREKLAELQEERNRKRKVDRTEDDTRSKE 110 YMQIREKLAELQEERN+ RKVDR E+D RSKE Sbjct: 300 YMQIREKLAELQEERNKSRKVDRHENDRRSKE 331