BLASTX nr result
ID: Zingiber23_contig00028230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00028230 (235 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004957083.1| PREDICTED: putative clathrin assembly protei... 56 4e-06 ref|XP_002462519.1| hypothetical protein SORBIDRAFT_02g027190 [S... 56 4e-06 gb|ACG47520.1| clathrin assembly protein [Zea mays] 56 4e-06 ref|NP_001130183.1| clathrin assembly protein [Zea mays] gi|1946... 56 4e-06 ref|XP_003576626.1| PREDICTED: putative clathrin assembly protei... 55 1e-05 >ref|XP_004957083.1| PREDICTED: putative clathrin assembly protein At4g40080-like [Setaria italica] Length = 336 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 230 ALLRHPTSGRNPLALSAFPLGSSPASFALASWVRWYAR 117 AL RHP SGRNPLAL+AFPLG S SFA ASWVR+ AR Sbjct: 112 ALARHPASGRNPLALAAFPLGRS--SFAAASWVRFSAR 147 >ref|XP_002462519.1| hypothetical protein SORBIDRAFT_02g027190 [Sorghum bicolor] gi|241925896|gb|EER99040.1| hypothetical protein SORBIDRAFT_02g027190 [Sorghum bicolor] Length = 350 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 230 ALLRHPTSGRNPLALSAFPLGSSPASFALASWVRWYAR 117 AL RHP SGRNPLALS+FPLG S SFA ASWVR+ AR Sbjct: 113 ALARHPASGRNPLALSSFPLGRS--SFAAASWVRFSAR 148 >gb|ACG47520.1| clathrin assembly protein [Zea mays] Length = 339 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 230 ALLRHPTSGRNPLALSAFPLGSSPASFALASWVRWYAR 117 AL RHP SGRNPLALS+FPLG S SFA ASWVR+ AR Sbjct: 112 ALARHPASGRNPLALSSFPLGRS--SFAAASWVRFSAR 147 >ref|NP_001130183.1| clathrin assembly protein [Zea mays] gi|194688488|gb|ACF78328.1| unknown [Zea mays] gi|414885854|tpg|DAA61868.1| TPA: clathrin assembly protein [Zea mays] Length = 341 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 230 ALLRHPTSGRNPLALSAFPLGSSPASFALASWVRWYAR 117 AL RHP SGRNPLALS+FPLG S SFA ASWVR+ AR Sbjct: 112 ALARHPASGRNPLALSSFPLGRS--SFAAASWVRFSAR 147 >ref|XP_003576626.1| PREDICTED: putative clathrin assembly protein At4g40080-like [Brachypodium distachyon] Length = 341 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 230 ALLRHPTSGRNPLALSAFPLGSSPASFALASWVRWYAR 117 AL+RHP SGRNPLAL+AFPLG SFA ASWVR+ AR Sbjct: 109 ALVRHPASGRNPLALAAFPLG---RSFATASWVRFSAR 143