BLASTX nr result
ID: Zingiber23_contig00028198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00028198 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513765.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 66 5e-09 ref|XP_002529612.1| arsenite inducuble RNA associated protein ai... 66 5e-09 gb|EXB93618.1| Zinc finger AN1 and C2H2 domain-containing stress... 65 1e-08 gb|EOY09286.1| Zinc finger (C2H2 type, AN1-like) family protein ... 65 1e-08 gb|EMJ03597.1| hypothetical protein PRUPE_ppa009445mg [Prunus pe... 64 3e-08 emb|CBI29856.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002283838.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 64 3e-08 emb|CAN79009.1| hypothetical protein VITISV_042473 [Vitis vinifera] 64 3e-08 ref|XP_004958078.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 62 6e-08 ref|XP_003535903.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 62 6e-08 ref|XP_006657863.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 62 1e-07 ref|XP_006489935.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 62 1e-07 ref|XP_004304391.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 62 1e-07 sp|Q0D5B9.2|SAP16_ORYSJ RecName: Full=Zinc finger AN1 and C2H2 d... 62 1e-07 ref|XP_002460884.1| hypothetical protein SORBIDRAFT_02g036840 [S... 62 1e-07 ref|NP_001060040.1| Os07g0569700 [Oryza sativa Japonica Group] g... 62 1e-07 gb|ESW17600.1| hypothetical protein PHAVU_007G253000g [Phaseolus... 61 1e-07 ref|XP_006421415.1| hypothetical protein CICLE_v10005558mg [Citr... 61 1e-07 ref|XP_003519070.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 61 1e-07 ref|XP_002308952.1| hypothetical protein POPTR_0006s05070g [Popu... 61 1e-07 >ref|XP_004513765.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Cicer arietinum] Length = 289 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCSKGFRDPVALVEHVERDHGGTS A Sbjct: 260 DVCPKCSKGFRDPVALVEHVERDHGGTSRA 289 >ref|XP_002529612.1| arsenite inducuble RNA associated protein aip-1, putative [Ricinus communis] gi|223530897|gb|EEF32757.1| arsenite inducuble RNA associated protein aip-1, putative [Ricinus communis] Length = 265 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCSKGFRDPVALVEHVERDHGGTS A Sbjct: 236 DVCPKCSKGFRDPVALVEHVERDHGGTSKA 265 >gb|EXB93618.1| Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16 [Morus notabilis] Length = 292 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCS+GFRDPVALVEHVERDHGGTS A Sbjct: 263 DVCPKCSRGFRDPVALVEHVERDHGGTSRA 292 >gb|EOY09286.1| Zinc finger (C2H2 type, AN1-like) family protein [Theobroma cacao] Length = 295 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCP+CSKGFRDPVALVEHVERDHGGTS A Sbjct: 266 DVCPRCSKGFRDPVALVEHVERDHGGTSKA 295 >gb|EMJ03597.1| hypothetical protein PRUPE_ppa009445mg [Prunus persica] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTS 266 D CPKCSKGFRDPVALVEHVERDHGGTS Sbjct: 263 DACPKCSKGFRDPVALVEHVERDHGGTS 290 >emb|CBI29856.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCS+GFRDPV+LVEHVERDHGGTS A Sbjct: 213 DVCPKCSRGFRDPVSLVEHVERDHGGTSKA 242 >ref|XP_002283838.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like isoform 1 [Vitis vinifera] Length = 293 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCS+GFRDPV+LVEHVERDHGGTS A Sbjct: 264 DVCPKCSRGFRDPVSLVEHVERDHGGTSKA 293 >emb|CAN79009.1| hypothetical protein VITISV_042473 [Vitis vinifera] Length = 339 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCS+GFRDPV+LVEHVERDHGGTS A Sbjct: 310 DVCPKCSRGFRDPVSLVEHVERDHGGTSKA 339 >ref|XP_004958078.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Setaria italica] Length = 290 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCSKGFRDPV LVEHVER+HGGTS A Sbjct: 261 DVCPKCSKGFRDPVLLVEHVEREHGGTSRA 290 >ref|XP_003535903.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Glycine max] Length = 278 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTS 266 DVCPKCS+GFRDPVALVEHVERDHGG+S Sbjct: 249 DVCPKCSRGFRDPVALVEHVERDHGGSS 276 >ref|XP_006657863.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Oryza brachyantha] Length = 292 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCSK FRDPV LVEHVERDHGGTS A Sbjct: 263 DVCPKCSKAFRDPVLLVEHVERDHGGTSRA 292 >ref|XP_006489935.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Citrus sinensis] Length = 289 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCS+GF DPVALVEHVERDHGGTS A Sbjct: 260 DVCPKCSRGFCDPVALVEHVERDHGGTSRA 289 >ref|XP_004304391.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11-like [Fragaria vesca subsp. vesca] Length = 292 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 D CPKCSKGFRDPVALVEHVE++HGGTS A Sbjct: 263 DACPKCSKGFRDPVALVEHVEKEHGGTSRA 292 >sp|Q0D5B9.2|SAP16_ORYSJ RecName: Full=Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16; Short=OsSAP16 gi|33146779|dbj|BAC79697.1| putative arsenite inducible RNA associated protein [Oryza sativa Japonica Group] gi|218199865|gb|EEC82292.1| hypothetical protein OsI_26540 [Oryza sativa Indica Group] gi|222637307|gb|EEE67439.1| hypothetical protein OsJ_24803 [Oryza sativa Japonica Group] gi|347737153|gb|AEP20538.1| zinc finger AN1 and C2H2 domain-containing protein [Oryza sativa Japonica Group] Length = 290 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCSK FRDPV LVEHVERDHGGTS A Sbjct: 261 DVCPKCSKAFRDPVLLVEHVERDHGGTSRA 290 >ref|XP_002460884.1| hypothetical protein SORBIDRAFT_02g036840 [Sorghum bicolor] gi|241924261|gb|EER97405.1| hypothetical protein SORBIDRAFT_02g036840 [Sorghum bicolor] Length = 351 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTS 266 DVCPKCSKGFRDPV LVEHVER+HGGTS Sbjct: 322 DVCPKCSKGFRDPVLLVEHVEREHGGTS 349 >ref|NP_001060040.1| Os07g0569700 [Oryza sativa Japonica Group] gi|113611576|dbj|BAF21954.1| Os07g0569700 [Oryza sativa Japonica Group] gi|323388877|gb|ADX60243.1| C2H2 transcription factor [Oryza sativa Japonica Group] Length = 97 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCSK FRDPV LVEHVERDHGGTS A Sbjct: 68 DVCPKCSKAFRDPVLLVEHVERDHGGTSRA 97 >gb|ESW17600.1| hypothetical protein PHAVU_007G253000g [Phaseolus vulgaris] Length = 285 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTS 266 DVCPKCS+GFRDPV+LVEHVERDHGG+S Sbjct: 256 DVCPKCSRGFRDPVSLVEHVERDHGGSS 283 >ref|XP_006421415.1| hypothetical protein CICLE_v10005558mg [Citrus clementina] gi|557523288|gb|ESR34655.1| hypothetical protein CICLE_v10005558mg [Citrus clementina] Length = 289 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 DVCPKCS+GF DPVALVEHVERDHGGTS A Sbjct: 260 DVCPKCSQGFCDPVALVEHVERDHGGTSRA 289 >ref|XP_003519070.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like isoform X1 [Glycine max] gi|571440745|ref|XP_006575248.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like isoform X2 [Glycine max] Length = 281 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTS 266 DVCPKCS+GFRDPVALVEHVE+DHGG+S Sbjct: 252 DVCPKCSRGFRDPVALVEHVEKDHGGSS 279 >ref|XP_002308952.1| hypothetical protein POPTR_0006s05070g [Populus trichocarpa] gi|222854928|gb|EEE92475.1| hypothetical protein POPTR_0006s05070g [Populus trichocarpa] Length = 292 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 DVCPKCSKGFRDPVALVEHVERDHGGTSLA 260 +VCPKCSKGFRDPVALVEHVERDH GTS A Sbjct: 263 EVCPKCSKGFRDPVALVEHVERDHRGTSKA 292