BLASTX nr result
ID: Zingiber23_contig00028125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00028125 (283 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGH18705.1| NRR-like protein [Triticum aestivum] 56 6e-06 dbj|BAD52461.1| hypothetical protein [Oryza sativa Japonica Grou... 55 1e-05 gb|AAW80625.1| NPR1 interactor [Oryza sativa Indica Group] gi|12... 55 1e-05 >gb|AGH18705.1| NRR-like protein [Triticum aestivum] Length = 128 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = -2 Query: 171 VNNDEVEEFFSILCRMRDATRSIG------VRRKAPQPAPALPLWSPTFVPEDFEGPDP 13 V++ EVE+F++IL RMRDA+R + R +AP PAP P W P+F EDF P P Sbjct: 26 VSDTEVEDFYAILRRMRDASRRLASGGVPAARARAPAPAPRAPAWCPSFSWEDFAPPAP 84 >dbj|BAD52461.1| hypothetical protein [Oryza sativa Japonica Group] gi|53791434|dbj|BAD52486.1| hypothetical protein [Oryza sativa Japonica Group] Length = 127 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -2 Query: 174 QVNNDEVEEFFSILCRMRDATRSIGVRRKAPQPAPALPLWSPTFVPEDFEGPDPK 10 +V++ EVEEF++IL RMRDATR +G R P P P W P+F EDF PK Sbjct: 27 EVSDAEVEEFYAILRRMRDATRRLGAR----PPPPRAPAWRPSFSWEDFADAPPK 77 >gb|AAW80625.1| NPR1 interactor [Oryza sativa Indica Group] gi|125524280|gb|EAY72394.1| hypothetical protein OsI_00248 [Oryza sativa Indica Group] Length = 131 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -2 Query: 174 QVNNDEVEEFFSILCRMRDATRSIGVRRKAPQPAPALPLWSPTFVPEDFEGPDPK 10 +V++ EVEEF++IL RMRDATR +G R P P P W P+F EDF PK Sbjct: 31 EVSDAEVEEFYAILRRMRDATRRLGAR----PPPPRAPAWRPSFSWEDFADAPPK 81