BLASTX nr result
ID: Zingiber23_contig00026319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00026319 (236 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532791.1| PREDICTED: calpain-type cysteine protease DE... 57 2e-06 ref|XP_002523419.1| calpain, putative [Ricinus communis] gi|2235... 56 4e-06 ref|XP_006580217.1| PREDICTED: calpain-type cysteine protease DE... 56 6e-06 ref|XP_006367593.1| PREDICTED: calpain-type cysteine protease DE... 55 7e-06 ref|XP_002285732.1| PREDICTED: uncharacterized protein LOC100244... 55 7e-06 gb|AAQ55288.2| phytocalpain [Nicotiana benthamiana] 55 7e-06 >ref|XP_003532791.1| PREDICTED: calpain-type cysteine protease DEK1-like [Glycine max] Length = 2151 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -1 Query: 236 EDVNCEKNVDNGSASIGFRSNSCRSVVHDSEV-VRTTDRHLDHNSSLVAC 90 + +N +K++D+G +S+ S+SCRSVVH+ EV + DR+LDHN+SLV C Sbjct: 419 DGINSDKSIDSGRSSLALHSSSCRSVVHEPEVGTSSDDRNLDHNNSLVVC 468 >ref|XP_002523419.1| calpain, putative [Ricinus communis] gi|223537369|gb|EEF38998.1| calpain, putative [Ricinus communis] Length = 2158 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = -1 Query: 236 EDVNCEKNVDNGSASIGFRSNSCRSVVHDSEVVRTTDRHLDHNSSLVAC 90 E +N + ++D+G S+ RS+SCRSVV + E + D+H DHN+SLV C Sbjct: 426 EGINSDNSIDSGRPSLALRSSSCRSVVQEPEAGTSGDKHFDHNNSLVVC 474 >ref|XP_006580217.1| PREDICTED: calpain-type cysteine protease DEK1-like [Glycine max] Length = 2150 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 236 EDVNCEKNVDNGSASIGFRSNSCRSVVHDSEV-VRTTDRHLDHNSSLVAC 90 + +N +K++D+G +S+ S+SCRS VH+ EV + DR+LDHN+SLV C Sbjct: 419 DGINSDKSIDSGRSSLALHSSSCRSAVHEPEVGTSSDDRNLDHNNSLVVC 468 >ref|XP_006367593.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X1 [Solanum tuberosum] gi|565404325|ref|XP_006367594.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X2 [Solanum tuberosum] Length = 2142 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 236 EDVNCEKNVDNGSASIGFRSNSCRSVVHDSEVVRT-TDRHLDHNSSLVAC 90 E +N +K++D+G S+ RS+SCRSVV + EV + DR+L+HNSSLV C Sbjct: 410 EGINSDKSIDSGRPSLALRSSSCRSVVQEPEVGSSYVDRNLEHNSSLVVC 459 >ref|XP_002285732.1| PREDICTED: uncharacterized protein LOC100244915 [Vitis vinifera] gi|297746484|emb|CBI16540.3| unnamed protein product [Vitis vinifera] Length = 2159 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = -1 Query: 236 EDVNCEKNVDNGSASIGFRSNSCRSVVHDSEVVRTTDRHLDHNSSLVAC 90 E +N +K++D+G S+ RS+SCRSV + E +TD++ DHNS LV C Sbjct: 425 EGINSDKSIDSGRPSLALRSSSCRSVAQEPEAGGSTDKNFDHNSCLVVC 473 >gb|AAQ55288.2| phytocalpain [Nicotiana benthamiana] Length = 2142 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 236 EDVNCEKNVDNGSASIGFRSNSCRSVVHDSEVVRT-TDRHLDHNSSLVAC 90 E +N +K++D+G S+ RS+SCRSVV + EV + DR+L+HNSSLV C Sbjct: 410 EGINSDKSIDSGRPSLALRSSSCRSVVQEPEVGSSYVDRNLEHNSSLVVC 459