BLASTX nr result
ID: Zingiber23_contig00023728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00023728 (504 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006651887.1| PREDICTED: uncharacterized protein LOC102713... 44 6e-07 ref|XP_002519146.1| conserved hypothetical protein [Ricinus comm... 41 7e-06 >ref|XP_006651887.1| PREDICTED: uncharacterized protein LOC102713815, partial [Oryza brachyantha] Length = 222 Score = 43.5 bits (101), Expect(3) = 6e-07 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +3 Query: 192 SNRESFYSDGIQLSP*DSRLSLYSGSAQIGVF 287 S R++F+S G+QLSP DSRLSL SG A++ VF Sbjct: 31 SGRDAFFSGGVQLSPCDSRLSLASGGAKLAVF 62 Score = 33.1 bits (74), Expect(3) = 6e-07 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +1 Query: 136 PCADSEVQRRDGFTFGL 186 PCAD+ VQR DGFTFG+ Sbjct: 12 PCADATVQRGDGFTFGV 28 Score = 21.6 bits (44), Expect(3) = 6e-07 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 284 VPEISLLTTNTS 319 V EISLLT NTS Sbjct: 66 VDEISLLTVNTS 77 >ref|XP_002519146.1| conserved hypothetical protein [Ricinus communis] gi|223541809|gb|EEF43357.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 41.2 bits (95), Expect(3) = 7e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 192 SNRESFYSDGIQLSP*DSRLSLYSGSAQIGVF 287 S++ESF+ D +QLSP DSRL+L+S AQ+ VF Sbjct: 51 SSKESFFFDHVQLSPCDSRLALFSKMAQLAVF 82 Score = 31.6 bits (70), Expect(3) = 7e-06 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = +1 Query: 136 PCADSEVQRRDGFTFGL 186 PC+D+++++ DGFTFGL Sbjct: 32 PCSDAKIEKSDGFTFGL 48 Score = 21.6 bits (44), Expect(3) = 7e-06 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 284 VPEISLLTTNTSNNPPACQAPFCIS 358 V EISLLT N+S P + ++ Sbjct: 86 VDEISLLTINSSTFNPGMSGGYMVA 110