BLASTX nr result
ID: Zingiber23_contig00019936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00019936 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002436401.1| hypothetical protein SORBIDRAFT_10g001870 [S... 56 4e-06 ref|XP_002511747.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_004964418.1| PREDICTED: coiled-coil domain-containing pro... 55 1e-05 >ref|XP_002436401.1| hypothetical protein SORBIDRAFT_10g001870 [Sorghum bicolor] gi|241914624|gb|EER87768.1| hypothetical protein SORBIDRAFT_10g001870 [Sorghum bicolor] Length = 240 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 4/74 (5%) Frame = -3 Query: 214 HGGETRLPPPPSVKELDVIPFKLRKIMEFRNE-NFSAVKQGHAPTSKDSRGQKKRKPVSD 38 HGG+TRLPPPP +EL+ IP KLR+++ F+N+ N +A K G +K +P ++ Sbjct: 17 HGGDTRLPPPPKHRELEAIPSKLRRLIAFQNKHNANADASSGGAAGKQDGGLRKNRPATE 76 Query: 37 ---CDSENNKKMNK 5 + +KK+ K Sbjct: 77 RTPTEKAKDKKIKK 90 >ref|XP_002511747.1| conserved hypothetical protein [Ricinus communis] gi|223548927|gb|EEF50416.1| conserved hypothetical protein [Ricinus communis] Length = 214 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/63 (41%), Positives = 38/63 (60%) Frame = -3 Query: 214 HGGETRLPPPPSVKELDVIPFKLRKIMEFRNENFSAVKQGHAPTSKDSRGQKKRKPVSDC 35 HGG +RLPPPP ++D +PFKLRKI+ + N SA K S+ ++++P SD Sbjct: 17 HGGHSRLPPPPDPSQVDALPFKLRKIISITSHNESA---------KPSKSSEEKRPSSDA 67 Query: 34 DSE 26 D + Sbjct: 68 DKK 70 >ref|XP_004964418.1| PREDICTED: coiled-coil domain-containing protein 137-like [Setaria italica] Length = 232 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 3/62 (4%) Frame = -3 Query: 214 HGGETRLPPPPSVKELDVIPFKLRKIMEFRN---ENFSAVKQGHAPTSKDSRGQKKRKPV 44 HGG++RLPPPP +EL+ IP KLR+++ F+N +N +A G K G K +P Sbjct: 17 HGGDSRLPPPPKQRELEAIPSKLRRLIAFQNKHDDNANAFSGGARAPGKQDDGLGKNRPA 76 Query: 43 SD 38 D Sbjct: 77 KD 78