BLASTX nr result
ID: Zingiber23_contig00019606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00019606 (601 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004951216.1| PREDICTED: uncharacterized protein LOC101773... 60 4e-07 >ref|XP_004951216.1| PREDICTED: uncharacterized protein LOC101773394 [Setaria italica] Length = 416 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 480 CRKLSEGVGPLEKQVREVFHRLVASRAEVIRCVDHTS 370 CR L +G+ PLE+QVR VFHR+VA RAEV+RC+DH+S Sbjct: 359 CRALEDGLAPLERQVRAVFHRVVACRAEVVRCIDHSS 395