BLASTX nr result
ID: Zingiber23_contig00019203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00019203 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853106.1| hypothetical protein AMTR_s00038p00129350 [A... 55 1e-05 ref|XP_004960691.1| PREDICTED: uncharacterized protein LOC101772... 55 1e-05 >ref|XP_006853106.1| hypothetical protein AMTR_s00038p00129350 [Amborella trichopoda] gi|548856745|gb|ERN14573.1| hypothetical protein AMTR_s00038p00129350 [Amborella trichopoda] Length = 70 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/74 (41%), Positives = 43/74 (58%) Frame = -3 Query: 355 MVSKVEESRLRRQESMRSKAQSGWSNEAKGKEPTAKKEVVRLHKVCKFKRSSFSEEEDAT 176 MVS+V ++ + + Q K KE + ++ K+C+FKRSS E+DAT Sbjct: 1 MVSRVHNTKKGGATLLEQQQQQQQMEALKRKE----QNMMMRSKLCRFKRSSIVGEDDAT 56 Query: 175 CSAMLLLACVVCNP 134 SA+LLLACVVCNP Sbjct: 57 TSAILLLACVVCNP 70 >ref|XP_004960691.1| PREDICTED: uncharacterized protein LOC101772248 [Setaria italica] Length = 76 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 226 KVCKFKRSSFSEEEDATCSAMLLLACVVCNP 134 K C+FKRSSFSEE+DA SAMLLLACVVC P Sbjct: 44 KACRFKRSSFSEEDDAASSAMLLLACVVCAP 74