BLASTX nr result
ID: Zingiber23_contig00019135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00019135 (541 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA36802.1| TPA: hypothetical protein ZEAMMB73_778251 [Zea m... 66 6e-09 ref|XP_002447382.1| hypothetical protein SORBIDRAFT_06g034070 [S... 66 6e-09 ref|XP_006654437.1| PREDICTED: multiple C2 and transmembrane dom... 65 8e-09 ref|XP_004963752.1| PREDICTED: multiple C2 and transmembrane dom... 65 8e-09 gb|AFW78199.1| phosphoribosylanthranilate transferase [Zea mays] 65 8e-09 ref|XP_002441149.1| hypothetical protein SORBIDRAFT_09g021260 [S... 65 8e-09 ref|NP_001182939.1| uncharacterized protein LOC100501234 [Zea ma... 65 8e-09 gb|EEC79273.1| hypothetical protein OsI_20060 [Oryza sativa Indi... 65 8e-09 ref|NP_001152458.1| phosphoribosylanthranilate transferase [Zea ... 65 8e-09 ref|NP_001055620.1| Os05g0429700 [Oryza sativa Japonica Group] g... 65 8e-09 ref|XP_004959939.1| PREDICTED: multiple C2 and transmembrane dom... 65 1e-08 dbj|BAJ91162.1| predicted protein [Hordeum vulgare subsp. vulgar... 65 1e-08 ref|XP_002273028.1| PREDICTED: multiple C2 and transmembrane dom... 65 1e-08 ref|XP_002273003.1| PREDICTED: multiple C2 and transmembrane dom... 65 1e-08 emb|CAN71789.1| hypothetical protein VITISV_004288 [Vitis vinifera] 65 1e-08 ref|XP_006653080.1| PREDICTED: extended synaptotagmin-1-like [Or... 64 2e-08 gb|AFW81852.1| phosphoribosylanthranilate transferase, mRNA [Zea... 64 2e-08 ref|XP_003568395.1| PREDICTED: multiple C2 and transmembrane dom... 64 2e-08 gb|ACN27041.1| unknown [Zea mays] 64 2e-08 gb|EAZ32519.1| hypothetical protein OsJ_16741 [Oryza sativa Japo... 64 2e-08 >tpg|DAA36802.1| TPA: hypothetical protein ZEAMMB73_778251 [Zea mays] Length = 1038 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSK PSVPFNFY+RLP+KSDMLL Sbjct: 1006 GLYLLRHPRFRSKQPSVPFNFYKRLPAKSDMLL 1038 >ref|XP_002447382.1| hypothetical protein SORBIDRAFT_06g034070 [Sorghum bicolor] gi|241938565|gb|EES11710.1| hypothetical protein SORBIDRAFT_06g034070 [Sorghum bicolor] Length = 1032 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSK PSVPFNFY+RLP+KSDMLL Sbjct: 1000 GLYLLRHPRFRSKQPSVPFNFYKRLPAKSDMLL 1032 >ref|XP_006654437.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Oryza brachyantha] Length = 803 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 772 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 803 >ref|XP_004963752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Setaria italica] Length = 781 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 750 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 781 >gb|AFW78199.1| phosphoribosylanthranilate transferase [Zea mays] Length = 809 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 778 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 809 >ref|XP_002441149.1| hypothetical protein SORBIDRAFT_09g021260 [Sorghum bicolor] gi|241946434|gb|EES19579.1| hypothetical protein SORBIDRAFT_09g021260 [Sorghum bicolor] Length = 808 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 777 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 808 >ref|NP_001182939.1| uncharacterized protein LOC100501234 [Zea mays] gi|238008304|gb|ACR35187.1| unknown [Zea mays] Length = 408 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 377 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 408 >gb|EEC79273.1| hypothetical protein OsI_20060 [Oryza sativa Indica Group] Length = 804 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 773 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 804 >ref|NP_001152458.1| phosphoribosylanthranilate transferase [Zea mays] gi|195656517|gb|ACG47726.1| phosphoribosylanthranilate transferase [Zea mays] Length = 809 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 778 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 809 >ref|NP_001055620.1| Os05g0429700 [Oryza sativa Japonica Group] gi|55733914|gb|AAV59421.1| putative anthranilate phosphoribosyltransferase [Oryza sativa Japonica Group] gi|113579171|dbj|BAF17534.1| Os05g0429700 [Oryza sativa Japonica Group] gi|215737213|dbj|BAG96142.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631675|gb|EEE63807.1| hypothetical protein OsJ_18631 [Oryza sativa Japonica Group] Length = 804 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSDMLL Sbjct: 773 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDMLL 804 >ref|XP_004959939.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Setaria italica] Length = 1023 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSK PSVPFNFY+RLP+K+DMLL Sbjct: 991 GLYLLRHPRFRSKQPSVPFNFYKRLPAKTDMLL 1023 >dbj|BAJ91162.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532660|dbj|BAJ89175.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1042 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 GMY+LRHP+FRSK PSVPFNFY+RLP+K DMLL Sbjct: 1010 GMYMLRHPRFRSKQPSVPFNFYKRLPAKGDMLL 1042 >ref|XP_002273028.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like isoform 2 [Vitis vinifera] Length = 1005 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSKMPSVP NF++RLPSKSDMLL Sbjct: 973 GLYLLRHPRFRSKMPSVPVNFFKRLPSKSDMLL 1005 >ref|XP_002273003.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like isoform 1 [Vitis vinifera] Length = 1002 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSKMPSVP NF++RLPSKSDMLL Sbjct: 970 GLYLLRHPRFRSKMPSVPVNFFKRLPSKSDMLL 1002 >emb|CAN71789.1| hypothetical protein VITISV_004288 [Vitis vinifera] Length = 916 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSKMPSVP NF++RLPSKSDMLL Sbjct: 884 GLYLLRHPRFRSKMPSVPVNFFKRLPSKSDMLL 916 >ref|XP_006653080.1| PREDICTED: extended synaptotagmin-1-like [Oryza brachyantha] Length = 738 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSK PSVPFNFY+RLP+KSD+LL Sbjct: 706 GLYLLRHPRFRSKQPSVPFNFYKRLPAKSDVLL 738 >gb|AFW81852.1| phosphoribosylanthranilate transferase, mRNA [Zea mays] Length = 796 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP++SDMLL Sbjct: 765 LYLLRHPRFRSRMPSVPFNFYRRLPARSDMLL 796 >ref|XP_003568395.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Brachypodium distachyon] Length = 804 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP+KSD+LL Sbjct: 773 LYLLRHPRFRSRMPSVPFNFYRRLPAKSDLLL 804 >gb|ACN27041.1| unknown [Zea mays] Length = 551 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -3 Query: 482 MYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 +YLLRHP+FRS+MPSVPFNFYRRLP++SDMLL Sbjct: 520 LYLLRHPRFRSRMPSVPFNFYRRLPARSDMLL 551 >gb|EAZ32519.1| hypothetical protein OsJ_16741 [Oryza sativa Japonica Group] Length = 1021 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 485 GMYLLRHPKFRSKMPSVPFNFYRRLPSKSDMLL 387 G+YLLRHP+FRSK PSVPFNFY+RLP+KSD+LL Sbjct: 989 GLYLLRHPRFRSKQPSVPFNFYKRLPAKSDVLL 1021