BLASTX nr result
ID: Zingiber23_contig00019041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00019041 (527 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO26315.1| putative 6-phosphogluconolactonase, partial [Elae... 58 1e-06 >gb|AAO26315.1| putative 6-phosphogluconolactonase, partial [Elaeis guineensis] Length = 270 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +2 Query: 71 GNEKTTNVLPVEMVSLEDGELTWFTDKAAVSMLRDKLSL 187 G + ++++LPVEMVSL+DG+ WFTDKAAVSMLR+K SL Sbjct: 232 GEQSSSDMLPVEMVSLKDGKFIWFTDKAAVSMLREKASL 270