BLASTX nr result
ID: Zingiber23_contig00017378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00017378 (262 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64372.1| hypothetical protein M569_10412, partial [Genlise... 57 3e-06 >gb|EPS64372.1| hypothetical protein M569_10412, partial [Genlisea aurea] Length = 214 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/60 (55%), Positives = 38/60 (63%) Frame = -3 Query: 188 VIIYSVSPKIIHATTSEFMTLVQRLTGQESADPHXXXXXXXXXXXXXXARIASFERPSPR 9 VIIY+VSPKIIH S+FM+LVQRLTG E+ DP AR+AS ER SPR Sbjct: 65 VIIYAVSPKIIHTNVSDFMSLVQRLTGSEAPDP----GGSGSGDVSPAARLASIERISPR 120