BLASTX nr result
ID: Zingiber23_contig00016966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00016966 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142210.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_002531339.1| pentatricopeptide repeat-containing protein,... 63 5e-08 ref|XP_002272943.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_003542463.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006846078.1| hypothetical protein AMTR_s00012p00087690 [A... 59 9e-07 ref|XP_006429052.1| hypothetical protein CICLE_v10013605mg [Citr... 58 1e-06 gb|EMJ09267.1| hypothetical protein PRUPE_ppa001736mg [Prunus pe... 57 3e-06 gb|EXC31687.1| hypothetical protein L484_008777 [Morus notabilis] 56 6e-06 ref|XP_006341056.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_004142210.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Cucumis sativus] gi|449525343|ref|XP_004169677.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Cucumis sativus] Length = 768 Score = 75.5 bits (184), Expect = 7e-12 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 3/107 (2%) Frame = -3 Query: 313 MAFSALLVHPCVLPAKPI-FESPPLQHKSLPFASFAS--IRGFASLSTAFDSNPMRQLPP 143 MAF+ + +P LP P+ F S P+ + S+ F++ S + +S ++ S+ + LPP Sbjct: 1 MAFTCVKCYPWSLPHAPLSFSSKPISNSSIFFSASLSDQLASSSSSNSTSSSHIVHHLPP 60 Query: 142 NFTPKDLLSIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 +FTPK L+ + RQ D A+L + NWA Q +F P+ SV+EE+LR+L Sbjct: 61 DFTPKQLIETLRRQTDEVAALRVFNWASKQPNFVPSSSVYEEILRKL 107 >ref|XP_002531339.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529061|gb|EEF31046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 630 Score = 62.8 bits (151), Expect = 5e-08 Identities = 37/102 (36%), Positives = 52/102 (50%) Frame = -3 Query: 307 FSALLVHPCVLPAKPIFESPPLQHKSLPFASFASIRGFASLSTAFDSNPMRQLPPNFTPK 128 F+ L +P P+ H+ PF+ F ++LS A L NFTP Sbjct: 6 FTCLKCYPLFFPS----------HQHPPFSFFHKPISNSTLSFASTQQHTATLSSNFTPA 55 Query: 127 DLLSIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 LL + RQ D A+L LL+WA Q +FRP S++EE+LR+L Sbjct: 56 QLLDTLRRQNDETAALRLLSWASKQPNFRPNSSIYEEILRKL 97 >ref|XP_002272943.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Vitis vinifera] Length = 772 Score = 62.8 bits (151), Expect = 5e-08 Identities = 41/115 (35%), Positives = 60/115 (52%), Gaps = 11/115 (9%) Frame = -3 Query: 313 MAFSALLVHPCVLPAKPIFESPPL---QHKSLPFASFASIRGF-----ASLSTAFDS--- 167 MAFS+ L P + + PP H PF+ S ++S +F + Sbjct: 1 MAFSSCLKWYPWTPPHTLTQPPPTLSSAHNCKPFSKLISFTSTHHHDQQAVSPSFSTLSP 60 Query: 166 NPMRQLPPNFTPKDLLSIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 +P QLP NFTPK L + RQ D ++ L+LL+WA Q +F P+ ++EEVLR+L Sbjct: 61 SPTTQLPQNFTPKQLRDALRRQSDEDSILDLLDWASKQPNFVPSSVIYEEVLRKL 115 >ref|XP_003542463.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Glycine max] Length = 756 Score = 61.2 bits (147), Expect = 1e-07 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 3/107 (2%) Frame = -3 Query: 313 MAFSALLVHPCVLPAKPIFESPPLQHKSLPFA-SFASIRGFASLSTAFDSNPMRQ--LPP 143 MA S+L HP P+ + Q + PF+ S +S F+S S S LPP Sbjct: 1 MALSSLHFHPL-----PLAYTVITQRHTTPFSFSLSSTFRFSSSSALSSSTSATHHPLPP 55 Query: 142 NFTPKDLLSIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 +F+P LL ++ RQ D+ ++L L WA Q ++ PSVF E+LRQL Sbjct: 56 DFSPSQLLDLLRRQPDSSSALSLFQWASAQPNYSAHPSVFHELLRQL 102 >ref|XP_006846078.1| hypothetical protein AMTR_s00012p00087690 [Amborella trichopoda] gi|548848848|gb|ERN07753.1| hypothetical protein AMTR_s00012p00087690 [Amborella trichopoda] Length = 805 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 9/99 (9%) Frame = -3 Query: 271 AKPIFESPPLQHKSLP---------FASFASIRGFASLSTAFDSNPMRQLPPNFTPKDLL 119 A P+ +PP + SL +S + +S + + + Q+PP+FT +DLL Sbjct: 53 AHPLQSTPPQKFLSLTERPNFSQCLASSQSQGLSISSKPNSLSPSSIHQIPPDFTTEDLL 112 Query: 118 SIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 SI+ RQ+DAEA+L++ N+A F PS++E VL+ L Sbjct: 113 SILNRQKDAEATLQIFNFASKHPSFITEPSIYEAVLKSL 151 >ref|XP_006429052.1| hypothetical protein CICLE_v10013605mg [Citrus clementina] gi|568854342|ref|XP_006480788.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Citrus sinensis] gi|557531109|gb|ESR42292.1| hypothetical protein CICLE_v10013605mg [Citrus clementina] Length = 768 Score = 58.2 bits (139), Expect = 1e-06 Identities = 42/106 (39%), Positives = 55/106 (51%), Gaps = 5/106 (4%) Frame = -3 Query: 304 SALLVHPCVLPAKPIFESPPLQHKSLPFASFASIRG-----FASLSTAFDSNPMRQLPPN 140 S L HP LP + + PL K SFAS + SLS++ S RQLP N Sbjct: 5 SCLKSHPWPLPRQSLL---PLSSKPTTI-SFASTQHHDHQQLTSLSSS-SSTFSRQLPSN 59 Query: 139 FTPKDLLSIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 FT LL + RQRD ++L L WA Q +F P S++EE+L +L Sbjct: 60 FTSTQLLDALRRQRDESSALRLFTWASKQPNFAPNSSLYEELLTKL 105 >gb|EMJ09267.1| hypothetical protein PRUPE_ppa001736mg [Prunus persica] Length = 772 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 5/88 (5%) Frame = -3 Query: 250 PPLQHKSLPFASFASIRGFASLSTAFD---SNPM--RQLPPNFTPKDLLSIIFRQRDAEA 86 P HK SF + L T S P+ LPP+FTP+ LL + RQ D + Sbjct: 26 PSSSHKLFTSLSFPLLHHHDQLVTHSSLSYSTPVSTHHLPPDFTPQQLLDTLRRQNDESS 85 Query: 85 SLELLNWALLQSHFRPTPSVFEEVLRQL 2 +L L +WA Q +F P +++EEVLR+L Sbjct: 86 ALRLFDWASKQPNFTPNSTIYEEVLRKL 113 >gb|EXC31687.1| hypothetical protein L484_008777 [Morus notabilis] Length = 781 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 3/93 (3%) Frame = -3 Query: 271 AKPIFESPPLQ--HKSLPFASFAS-IRGFASLSTAFDSNPMRQLPPNFTPKDLLSIIFRQ 101 +KP PPL +K+ +SF+S I S+ ++ ++P LPP+FT LL + RQ Sbjct: 23 SKPPSPFPPLSFPNKTNLSSSFSSPIHKNFSIQSSSSTSPTPLLPPDFTSNQLLDAVRRQ 82 Query: 100 RDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 D ++L L WA Q +F P+P ++ E+L +L Sbjct: 83 NDESSALRLFEWASNQPNFSPSPLLYNEILGKL 115 >ref|XP_006341056.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Solanum tuberosum] Length = 766 Score = 55.8 bits (133), Expect = 6e-06 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 5/109 (4%) Frame = -3 Query: 313 MAFSA---LLVHPCVLPAKPI--FESPPLQHKSLPFASFASIRGFASLSTAFDSNPMRQL 149 MAFS L HP P F PP H P + S R ST S ++L Sbjct: 1 MAFSFSSFLKCHPWTQSQNPPNPFSFPPPFHPPKPISLPFSSRHERVSSTVLPSKA-KEL 59 Query: 148 PPNFTPKDLLSIIFRQRDAEASLELLNWALLQSHFRPTPSVFEEVLRQL 2 +FTPK L + ++ D ++ L WA Q HF PT S++EE+LR+L Sbjct: 60 LQDFTPKQFLDTLRQENDETSAFHLFKWASKQPHFTPTLSIYEEILRKL 108