BLASTX nr result
ID: Zingiber23_contig00015985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00015985 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854190.1| hypothetical protein AMTR_s00048p00205490 [A... 172 5e-41 gb|ADA85630.1| early responsive to dehydration 3 protein [Pinus ... 170 2e-40 gb|EPS60043.1| hypothetical protein M569_14761, partial [Genlise... 169 3e-40 ref|XP_006432561.1| hypothetical protein CICLE_v10000643mg [Citr... 169 4e-40 ref|XP_006432559.1| hypothetical protein CICLE_v10000643mg [Citr... 169 4e-40 ref|XP_004144403.1| PREDICTED: probable methyltransferase PMT21-... 169 5e-40 gb|EMJ11467.1| hypothetical protein PRUPE_ppa003130mg [Prunus pe... 168 8e-40 gb|EMJ11465.1| hypothetical protein PRUPE_ppa003130mg [Prunus pe... 168 8e-40 gb|AAW72877.1| early response to drought 3 [Pinus taeda] 168 8e-40 gb|AAW72852.1| early response to drought 3 [Pinus taeda] gi|5839... 168 8e-40 gb|AEW70174.1| early responsive to dehydration 3, partial [Pinus... 168 8e-40 gb|AEW70171.1| early responsive to dehydration 3, partial [Pinus... 168 8e-40 gb|AEW70169.1| early responsive to dehydration 3, partial [Pinus... 168 8e-40 gb|AEW70168.1| early responsive to dehydration 3, partial [Pinus... 168 8e-40 gb|ADV32343.1| early responsive to dehydration 3 [Pinus sylvestris] 168 8e-40 gb|ADA85626.1| early responsive to dehydration 3 protein [Pinus ... 168 8e-40 gb|ACO57101.1| early responsive to dehydration 3 [Pinus halepensis] 168 8e-40 gb|ACB59070.1| early response to drought 3 [Pinus elliottii] 168 8e-40 gb|ABS83492.1| early response to drought 3 [Pinus pinaster] 168 8e-40 gb|EXB49810.1| putative methyltransferase PMT21 [Morus notabilis] 167 1e-39 >ref|XP_006854190.1| hypothetical protein AMTR_s00048p00205490 [Amborella trichopoda] gi|548857859|gb|ERN15657.1| hypothetical protein AMTR_s00048p00205490 [Amborella trichopoda] Length = 599 Score = 172 bits (435), Expect = 5e-41 Identities = 79/87 (90%), Positives = 82/87 (94%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI PIWVMN+VSSY NSLG+VYDRGLIGTYHDWCE FSTYP Sbjct: 450 IRNVMDMNTLYGGFAAALIADPIWVMNVVSSYSVNSLGVVYDRGLIGTYHDWCEAFSTYP 509 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFT+ESHRCEMKYVLLE Sbjct: 510 RTYDLLHLDGLFTSESHRCEMKYVLLE 536 >gb|ADA85630.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|317543837|gb|ADV32379.1| early responsive to dehydration 3 [Pinus sylvestris] Length = 125 Score = 170 bits (430), Expect = 2e-40 Identities = 77/87 (88%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALID P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 4 IRNVMDMNTLYGGFAAALIDDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 63 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 64 RTYDLLHVDGLFSAESHRCEMKYVLLE 90 >gb|EPS60043.1| hypothetical protein M569_14761, partial [Genlisea aurea] Length = 322 Score = 169 bits (429), Expect = 3e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNT+YGGFAA+LIDSP+WVMN+VSSY NSL +V+DRGLIGTYHDWCE FSTYP Sbjct: 172 IRNVMDMNTVYGGFAASLIDSPLWVMNVVSSYSDNSLPVVFDRGLIGTYHDWCEAFSTYP 231 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLFTAESHRCEMKYVLLE Sbjct: 232 RTYDLLHVDGLFTAESHRCEMKYVLLE 258 >ref|XP_006432561.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|557534683|gb|ESR45801.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] Length = 429 Score = 169 bits (428), Expect = 4e-40 Identities = 75/87 (86%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAA+ID P+WVMN+VSSY +N+L +VYDRGLIGTYHDWCE FSTYP Sbjct: 279 IRNVMDMNTLYGGFAAAVIDDPLWVMNVVSSYAANTLAVVYDRGLIGTYHDWCEAFSTYP 338 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFTAESHRC+MK+VLLE Sbjct: 339 RTYDLLHLDGLFTAESHRCDMKFVLLE 365 >ref|XP_006432559.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|567880003|ref|XP_006432560.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|567880007|ref|XP_006432562.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|567880009|ref|XP_006432563.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|557534681|gb|ESR45799.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|557534682|gb|ESR45800.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|557534684|gb|ESR45802.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] gi|557534685|gb|ESR45803.1| hypothetical protein CICLE_v10000643mg [Citrus clementina] Length = 601 Score = 169 bits (428), Expect = 4e-40 Identities = 75/87 (86%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAA+ID P+WVMN+VSSY +N+L +VYDRGLIGTYHDWCE FSTYP Sbjct: 451 IRNVMDMNTLYGGFAAAVIDDPLWVMNVVSSYAANTLAVVYDRGLIGTYHDWCEAFSTYP 510 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFTAESHRC+MK+VLLE Sbjct: 511 RTYDLLHLDGLFTAESHRCDMKFVLLE 537 >ref|XP_004144403.1| PREDICTED: probable methyltransferase PMT21-like [Cucumis sativus] gi|449524378|ref|XP_004169200.1| PREDICTED: probable methyltransferase PMT21-like [Cucumis sativus] Length = 602 Score = 169 bits (427), Expect = 5e-40 Identities = 75/87 (86%), Positives = 82/87 (94%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNT+YGGFAAA+ID P+WVMN+VSSY +N+L +VYDRGLIGTYHDWCE FSTYP Sbjct: 452 IRNVMDMNTVYGGFAAAIIDDPLWVMNVVSSYAANTLPVVYDRGLIGTYHDWCEAFSTYP 511 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFTAE HRCEMKYVLLE Sbjct: 512 RTYDLLHLDGLFTAEGHRCEMKYVLLE 538 >gb|EMJ11467.1| hypothetical protein PRUPE_ppa003130mg [Prunus persica] Length = 600 Score = 168 bits (425), Expect = 8e-40 Identities = 75/87 (86%), Positives = 82/87 (94%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNT+YGGFAA +ID P+WVMN+VSSY +N+L +VYDRGLIGTYHDWCE FSTYP Sbjct: 450 IRNVMDMNTVYGGFAAGMIDYPLWVMNVVSSYAANTLPVVYDRGLIGTYHDWCEAFSTYP 509 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFTAESHRCEMKYVLLE Sbjct: 510 RTYDLLHLDGLFTAESHRCEMKYVLLE 536 >gb|EMJ11465.1| hypothetical protein PRUPE_ppa003130mg [Prunus persica] Length = 515 Score = 168 bits (425), Expect = 8e-40 Identities = 75/87 (86%), Positives = 82/87 (94%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNT+YGGFAA +ID P+WVMN+VSSY +N+L +VYDRGLIGTYHDWCE FSTYP Sbjct: 365 IRNVMDMNTVYGGFAAGMIDYPLWVMNVVSSYAANTLPVVYDRGLIGTYHDWCEAFSTYP 424 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFTAESHRCEMKYVLLE Sbjct: 425 RTYDLLHLDGLFTAESHRCEMKYVLLE 451 >gb|AAW72877.1| early response to drought 3 [Pinus taeda] Length = 207 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 56 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 115 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 116 RTYDLLHVDGLFSAESHRCEMKYVLLE 142 >gb|AAW72852.1| early response to drought 3 [Pinus taeda] gi|58397203|gb|AAW72853.1| early response to drought 3 [Pinus taeda] gi|58397205|gb|AAW72854.1| early response to drought 3 [Pinus taeda] gi|58397207|gb|AAW72855.1| early response to drought 3 [Pinus taeda] gi|58397209|gb|AAW72856.1| early response to drought 3 [Pinus taeda] gi|58397211|gb|AAW72857.1| early response to drought 3 [Pinus taeda] gi|58397213|gb|AAW72858.1| early response to drought 3 [Pinus taeda] gi|58397215|gb|AAW72859.1| early response to drought 3 [Pinus taeda] gi|58397217|gb|AAW72860.1| early response to drought 3 [Pinus taeda] gi|58397219|gb|AAW72861.1| early response to drought 3 [Pinus taeda] gi|58397221|gb|AAW72862.1| early response to drought 3 [Pinus taeda] gi|58397223|gb|AAW72863.1| early response to drought 3 [Pinus taeda] gi|58397225|gb|AAW72864.1| early response to drought 3 [Pinus taeda] gi|58397227|gb|AAW72865.1| early response to drought 3 [Pinus taeda] gi|58397229|gb|AAW72866.1| early response to drought 3 [Pinus taeda] gi|58397231|gb|AAW72867.1| early response to drought 3 [Pinus taeda] gi|58397235|gb|AAW72869.1| early response to drought 3 [Pinus taeda] gi|58397237|gb|AAW72870.1| early response to drought 3 [Pinus taeda] gi|58397239|gb|AAW72871.1| early response to drought 3 [Pinus taeda] gi|58397241|gb|AAW72872.1| early response to drought 3 [Pinus taeda] gi|58397243|gb|AAW72873.1| early response to drought 3 [Pinus taeda] gi|58397245|gb|AAW72874.1| early response to drought 3 [Pinus taeda] gi|58397247|gb|AAW72875.1| early response to drought 3 [Pinus taeda] gi|58397249|gb|AAW72876.1| early response to drought 3 [Pinus taeda] gi|58397253|gb|AAW72878.1| early response to drought 3 [Pinus taeda] gi|58397255|gb|AAW72879.1| early response to drought 3 [Pinus taeda] gi|58397257|gb|AAW72880.1| early response to drought 3 [Pinus taeda] gi|58397259|gb|AAW72881.1| early response to drought 3 [Pinus taeda] gi|58397261|gb|AAW72882.1| early response to drought 3 [Pinus taeda] gi|58397263|gb|AAW72883.1| early response to drought 3 [Pinus taeda] gi|171920014|gb|ACB59068.1| early response to drought 3 [Pinus radiata] gi|171920016|gb|ACB59069.1| early response to drought 3 [Pinus radiata] gi|171920021|gb|ACB59071.1| early response to drought 3 [Pinus elliottii] Length = 207 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 56 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 115 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 116 RTYDLLHVDGLFSAESHRCEMKYVLLE 142 >gb|AEW70174.1| early responsive to dehydration 3, partial [Pinus densiflora var. ussuriensis] gi|365266585|gb|AEW70178.1| early responsive to dehydration 3, partial [Pinus densiflora var. ussuriensis] gi|365266591|gb|AEW70181.1| early responsive to dehydration 3, partial [Pinus densiflora] gi|365266593|gb|AEW70182.1| early responsive to dehydration 3, partial [Pinus densiflora] Length = 185 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 34 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 93 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 94 RTYDLLHVDGLFSAESHRCEMKYVLLE 120 >gb|AEW70171.1| early responsive to dehydration 3, partial [Pinus sylvestris var. mongolica] Length = 185 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 34 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 93 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 94 RTYDLLHVDGLFSAESHRCEMKYVLLE 120 >gb|AEW70169.1| early responsive to dehydration 3, partial [Pinus sylvestris var. mongolica] gi|365266569|gb|AEW70170.1| early responsive to dehydration 3, partial [Pinus sylvestris var. mongolica] gi|365266573|gb|AEW70172.1| early responsive to dehydration 3, partial [Pinus sylvestris var. mongolica] Length = 185 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 34 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 93 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 94 RTYDLLHVDGLFSAESHRCEMKYVLLE 120 >gb|AEW70168.1| early responsive to dehydration 3, partial [Pinus sylvestris var. mongolica] gi|365266575|gb|AEW70173.1| early responsive to dehydration 3, partial [Pinus sylvestris var. mongolica] gi|365266579|gb|AEW70175.1| early responsive to dehydration 3, partial [Pinus densiflora var. densiflora] Length = 185 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 34 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 93 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 94 RTYDLLHVDGLFSAESHRCEMKYVLLE 120 >gb|ADV32343.1| early responsive to dehydration 3 [Pinus sylvestris] Length = 125 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 4 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 63 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 64 RTYDLLHVDGLFSAESHRCEMKYVLLE 90 >gb|ADA85626.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767185|gb|ADA85627.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767187|gb|ADA85628.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767189|gb|ADA85629.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767193|gb|ADA85631.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767195|gb|ADA85632.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767197|gb|ADA85633.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767201|gb|ADA85635.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767203|gb|ADA85636.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767205|gb|ADA85637.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767207|gb|ADA85638.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767209|gb|ADA85639.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767211|gb|ADA85640.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767213|gb|ADA85641.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767215|gb|ADA85642.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767217|gb|ADA85643.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767219|gb|ADA85644.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767223|gb|ADA85646.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767225|gb|ADA85647.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767227|gb|ADA85648.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767229|gb|ADA85649.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767231|gb|ADA85650.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767233|gb|ADA85651.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767235|gb|ADA85652.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767237|gb|ADA85653.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767239|gb|ADA85654.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767241|gb|ADA85655.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767243|gb|ADA85656.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767245|gb|ADA85657.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767247|gb|ADA85658.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767249|gb|ADA85659.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767251|gb|ADA85660.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767253|gb|ADA85661.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767255|gb|ADA85662.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|282767257|gb|ADA85663.1| early responsive to dehydration 3 protein [Pinus sylvestris] gi|317543743|gb|ADV32332.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543745|gb|ADV32333.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543747|gb|ADV32334.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543749|gb|ADV32335.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543751|gb|ADV32336.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543753|gb|ADV32337.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543755|gb|ADV32338.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543757|gb|ADV32339.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543759|gb|ADV32340.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543761|gb|ADV32341.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543763|gb|ADV32342.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543767|gb|ADV32344.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543769|gb|ADV32345.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543771|gb|ADV32346.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543773|gb|ADV32347.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543775|gb|ADV32348.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543777|gb|ADV32349.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543779|gb|ADV32350.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543781|gb|ADV32351.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543783|gb|ADV32352.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543785|gb|ADV32353.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543787|gb|ADV32354.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543789|gb|ADV32355.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543791|gb|ADV32356.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543793|gb|ADV32357.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543795|gb|ADV32358.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543797|gb|ADV32359.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543799|gb|ADV32360.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543801|gb|ADV32361.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543803|gb|ADV32362.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543805|gb|ADV32363.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543807|gb|ADV32364.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543809|gb|ADV32365.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543811|gb|ADV32366.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543813|gb|ADV32367.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543815|gb|ADV32368.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543817|gb|ADV32369.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543819|gb|ADV32370.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543821|gb|ADV32371.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543823|gb|ADV32372.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543827|gb|ADV32374.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543829|gb|ADV32375.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543831|gb|ADV32376.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543833|gb|ADV32377.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543835|gb|ADV32378.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543839|gb|ADV32380.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543841|gb|ADV32381.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543843|gb|ADV32382.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543845|gb|ADV32383.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543847|gb|ADV32384.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543849|gb|ADV32385.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543851|gb|ADV32386.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543853|gb|ADV32387.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543855|gb|ADV32388.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543859|gb|ADV32390.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543861|gb|ADV32391.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543863|gb|ADV32392.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543865|gb|ADV32393.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543867|gb|ADV32394.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543869|gb|ADV32395.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543871|gb|ADV32396.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543873|gb|ADV32397.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543875|gb|ADV32398.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543877|gb|ADV32399.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543879|gb|ADV32400.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543881|gb|ADV32401.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543883|gb|ADV32402.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543885|gb|ADV32403.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543887|gb|ADV32404.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543889|gb|ADV32405.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543891|gb|ADV32406.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543893|gb|ADV32407.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543895|gb|ADV32408.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543897|gb|ADV32409.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543899|gb|ADV32410.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543901|gb|ADV32411.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543903|gb|ADV32412.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543905|gb|ADV32413.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543907|gb|ADV32414.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543909|gb|ADV32415.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543911|gb|ADV32416.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543913|gb|ADV32417.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543915|gb|ADV32418.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543919|gb|ADV32420.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543921|gb|ADV32421.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543923|gb|ADV32422.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543925|gb|ADV32423.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543927|gb|ADV32424.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543929|gb|ADV32425.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543931|gb|ADV32426.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543933|gb|ADV32427.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543935|gb|ADV32428.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543937|gb|ADV32429.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543939|gb|ADV32430.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543941|gb|ADV32431.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543943|gb|ADV32432.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543945|gb|ADV32433.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543947|gb|ADV32434.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543949|gb|ADV32435.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543951|gb|ADV32436.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543953|gb|ADV32437.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543955|gb|ADV32438.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543957|gb|ADV32439.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543959|gb|ADV32440.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543961|gb|ADV32441.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543963|gb|ADV32442.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543965|gb|ADV32443.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543967|gb|ADV32444.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543969|gb|ADV32445.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543971|gb|ADV32446.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543973|gb|ADV32447.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543975|gb|ADV32448.1| early responsive to dehydration 3 [Pinus sylvestris] gi|317543977|gb|ADV32449.1| early responsive to dehydration 3 [Pinus sylvestris] Length = 125 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 4 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 63 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 64 RTYDLLHVDGLFSAESHRCEMKYVLLE 90 >gb|ACO57101.1| early responsive to dehydration 3 [Pinus halepensis] Length = 201 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 50 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 109 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 110 RTYDLLHVDGLFSAESHRCEMKYVLLE 136 >gb|ACB59070.1| early response to drought 3 [Pinus elliottii] Length = 207 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 56 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 115 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 116 RTYDLLHVDGLFSAESHRCEMKYVLLE 142 >gb|ABS83492.1| early response to drought 3 [Pinus pinaster] Length = 183 Score = 168 bits (425), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNTLYGGFAAALI+ P+WVMN+VSSYG NSL +VYDRGLIGTY+DWCE FSTYP Sbjct: 32 IRNVMDMNTLYGGFAAALINDPLWVMNVVSSYGLNSLNVVYDRGLIGTYNDWCEAFSTYP 91 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLH+DGLF+AESHRCEMKYVLLE Sbjct: 92 RTYDLLHVDGLFSAESHRCEMKYVLLE 118 >gb|EXB49810.1| putative methyltransferase PMT21 [Morus notabilis] Length = 606 Score = 167 bits (423), Expect = 1e-39 Identities = 74/87 (85%), Positives = 83/87 (95%) Frame = -3 Query: 262 IRNVMDMNTLYGGFAAALIDSPIWVMNIVSSYGSNSLGIVYDRGLIGTYHDWCEPFSTYP 83 IRNVMDMNT+YGGFAAA+ID P+WVMN+VSSY +N+L +V+DRGLIGTYHDWCE FSTYP Sbjct: 456 IRNVMDMNTVYGGFAAAVIDDPLWVMNVVSSYAANTLPVVFDRGLIGTYHDWCEAFSTYP 515 Query: 82 RTYDLLHLDGLFTAESHRCEMKYVLLE 2 RTYDLLHLDGLFTAESHRC+MKYVLLE Sbjct: 516 RTYDLLHLDGLFTAESHRCDMKYVLLE 542