BLASTX nr result
ID: Zingiber23_contig00015205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00015205 (710 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 56 1e-05 gb|ABD96938.1| hypothetical protein [Cleome spinosa] 56 1e-05 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 56.2 bits (134), Expect = 1e-05 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 489 LSGCMLSSTLRRRTQMVQSFSVVFLYWFYVF 397 +SG M++STLRRRT +VQSFSVVFLYWFY+F Sbjct: 8 ISGFMINSTLRRRTHLVQSFSVVFLYWFYIF 38 >gb|ABD96938.1| hypothetical protein [Cleome spinosa] Length = 174 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -1 Query: 119 STSEEEEHRALIAQRKLRRMLSNRESARRSRLRKQKHM 6 STS+EE+ ++I +RK RRM+SNRESARRSR+RKQ+H+ Sbjct: 63 STSDEEQQLSIIKERKQRRMISNRESARRSRMRKQRHL 100