BLASTX nr result
ID: Zingiber23_contig00014829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00014829 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW21291.1| hypothetical protein PHAVU_005G058400g [Phaseolus... 57 3e-06 ref|XP_006585415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 57 3e-06 gb|ESW21290.1| hypothetical protein PHAVU_005G058300g [Phaseolus... 56 4e-06 ref|XP_006852577.1| hypothetical protein AMTR_s00021p00210180 [A... 55 1e-05 ref|XP_003626790.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 55 1e-05 >gb|ESW21291.1| hypothetical protein PHAVU_005G058400g [Phaseolus vulgaris] Length = 367 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 363 SVAMFFV-GVREDNYLYGPIKEILSENEAPKYREFLLEEYFQVFASRGIGTESILRRFTL 187 SVA FF G++ LYGPIKE+LSE+ PKYRE +EEY + F +G+ S L F + Sbjct: 308 SVACFFSEGLKSSGKLYGPIKELLSEDNPPKYRETTVEEYVRYFNEKGLDGTSALHHFRI 367 >ref|XP_006585415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 3-like [Glycine max] Length = 86 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/60 (46%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 363 SVAMFF-VGVREDNYLYGPIKEILSENEAPKYREFLLEEYFQVFASRGIGTESILRRFTL 187 S+A FF G++ LYGPIKE+LSE+ PKYRE + EY + F ++G+G S L+ F + Sbjct: 27 SIACFFSAGLKSSPKLYGPIKELLSEDNHPKYRETTVAEYVRHFNAKGLGGTSALQHFRI 86 >gb|ESW21290.1| hypothetical protein PHAVU_005G058300g [Phaseolus vulgaris] Length = 367 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/60 (46%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 363 SVAMFFV-GVREDNYLYGPIKEILSENEAPKYREFLLEEYFQVFASRGIGTESILRRFTL 187 SVA FF G++ LYGPIKE+LSE+ PKYRE +EEY + + +G+ S L F + Sbjct: 308 SVACFFSEGLKSSGKLYGPIKELLSEDNPPKYREIAVEEYARYYVEKGLDGTSALDHFRI 367 >ref|XP_006852577.1| hypothetical protein AMTR_s00021p00210180 [Amborella trichopoda] gi|548856188|gb|ERN14044.1| hypothetical protein AMTR_s00021p00210180 [Amborella trichopoda] Length = 361 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 363 SVAMFFV-GVREDNYLYGPIKEILSENEAPKYREFLLEEYFQVFASRGIGTESILRRFTL 187 SVA+F+ G R+D+ YGPI+E+LS PKYR F + EY F ++G+ S+L F L Sbjct: 302 SVAIFYSPGKRDDSTFYGPIEELLSPQNPPKYRNFTMTEYLGTFFNKGLKRNSLLDHFKL 361 >ref|XP_003626790.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355520812|gb|AET01266.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 365 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -3 Query: 363 SVAMFF-VGVREDNYLYGPIKEILSENEAPKYREFLLEEYFQVFASRGIGTESILRRFTL 187 SVA FF G+R + LYGPIKE+LSE+ PKYRE + +Y F +G+ S L + + Sbjct: 306 SVACFFCTGIRSSSKLYGPIKELLSEDNPPKYRETTVSDYVAYFEKKGLDGTSALTHYKI 365