BLASTX nr result
ID: Zingiber23_contig00013948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00013948 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC35052.1| putative histone H2B.1 [Morus notabilis] 86 5e-15 gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] 86 5e-15 ref|XP_006409905.1| hypothetical protein EUTSA_v10017370mg [Eutr... 86 5e-15 ref|XP_006384170.1| hypothetical protein POPTR_0004s09030g [Popu... 86 5e-15 ref|XP_006379009.1| hypothetical protein POPTR_0009s03310g [Popu... 86 5e-15 ref|XP_006841044.1| hypothetical protein AMTR_s00085p00145460 [A... 86 5e-15 gb|EOY34119.1| Histone superfamily protein [Theobroma cacao] 86 5e-15 gb|EOY07601.1| Histone superfamily protein [Theobroma cacao] 86 5e-15 ref|XP_004302789.1| PREDICTED: histone H2B-like [Fragaria vesca ... 86 5e-15 gb|EMJ09025.1| hypothetical protein PRUPE_ppa023550mg [Prunus pe... 86 5e-15 ref|NP_180440.1| histone H2B [Arabidopsis thaliana] gi|75206064... 86 5e-15 ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arab... 86 5e-15 ref|XP_002305858.1| histone 2 [Populus trichocarpa] gi|224106525... 86 5e-15 ref|XP_002301712.1| histone 2 [Populus trichocarpa] gi|566171381... 86 5e-15 ref|XP_006654514.1| PREDICTED: histone H2B.11-like [Oryza brachy... 86 7e-15 ref|XP_006649859.1| PREDICTED: histone H2B.1-like [Oryza brachya... 86 7e-15 ref|XP_004970520.1| PREDICTED: histone H2B.11-like [Setaria ital... 86 7e-15 ref|XP_004961843.1| PREDICTED: histone H2B.2-like [Setaria italica] 86 7e-15 gb|EMT26655.1| Putative histone H2B.1 [Aegilops tauschii] 86 7e-15 gb|EMS49652.1| putative histone H2B.1 [Triticum urartu] 86 7e-15 >gb|EXC35052.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 58 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 100 >gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 58 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 100 >ref|XP_006409905.1| hypothetical protein EUTSA_v10017370mg [Eutrema salsugineum] gi|557111074|gb|ESQ51358.1| hypothetical protein EUTSA_v10017370mg [Eutrema salsugineum] Length = 152 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 62 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 104 >ref|XP_006384170.1| hypothetical protein POPTR_0004s09030g [Populus trichocarpa] gi|550340640|gb|ERP61967.1| hypothetical protein POPTR_0004s09030g [Populus trichocarpa] Length = 147 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 57 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 99 >ref|XP_006379009.1| hypothetical protein POPTR_0009s03310g [Populus trichocarpa] gi|550330942|gb|ERP56806.1| hypothetical protein POPTR_0009s03310g [Populus trichocarpa] Length = 148 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 58 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 100 >ref|XP_006841044.1| hypothetical protein AMTR_s00085p00145460 [Amborella trichopoda] gi|548842936|gb|ERN02719.1| hypothetical protein AMTR_s00085p00145460 [Amborella trichopoda] Length = 136 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 46 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 88 >gb|EOY34119.1| Histone superfamily protein [Theobroma cacao] Length = 148 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 58 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 100 >gb|EOY07601.1| Histone superfamily protein [Theobroma cacao] Length = 139 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 49 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 91 >ref|XP_004302789.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca] Length = 130 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 40 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 82 >gb|EMJ09025.1| hypothetical protein PRUPE_ppa023550mg [Prunus persica] Length = 134 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 44 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 86 >ref|NP_180440.1| histone H2B [Arabidopsis thaliana] gi|75206064|sp|Q9SI96.3|H2B3_ARATH RecName: Full=Histone H2B.3; Short=HTB3 gi|13272409|gb|AAK17143.1|AF325075_1 putative histone H2B [Arabidopsis thaliana] gi|4580384|gb|AAD24363.1| putative histone H2B [Arabidopsis thaliana] gi|16209685|gb|AAL14400.1| At2g28720/T11P11.3 [Arabidopsis thaliana] gi|21553526|gb|AAM62619.1| putative histone H2B [Arabidopsis thaliana] gi|21700841|gb|AAM70544.1| At2g28720/T11P11.3 [Arabidopsis thaliana] gi|330253069|gb|AEC08163.1| histone H2B [Arabidopsis thaliana] Length = 151 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 61 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 103 >ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. lyrata] gi|297325021|gb|EFH55441.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. lyrata] Length = 154 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 64 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 106 >ref|XP_002305858.1| histone 2 [Populus trichocarpa] gi|224106525|ref|XP_002314196.1| histone 2 [Populus trichocarpa] Length = 93 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 3 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 45 >ref|XP_002301712.1| histone 2 [Populus trichocarpa] gi|566171381|ref|XP_006383343.1| histone H2B family protein [Populus trichocarpa] gi|118489629|gb|ABK96616.1| unknown [Populus trichocarpa x Populus deltoides] gi|550338952|gb|ERP61140.1| histone H2B family protein [Populus trichocarpa] Length = 148 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 183 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQE Sbjct: 58 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 100 >ref|XP_006654514.1| PREDICTED: histone H2B.11-like [Oryza brachyantha] Length = 145 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 186 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE Sbjct: 56 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 97 >ref|XP_006649859.1| PREDICTED: histone H2B.1-like [Oryza brachyantha] Length = 151 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 186 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE Sbjct: 62 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 103 >ref|XP_004970520.1| PREDICTED: histone H2B.11-like [Setaria italica] Length = 139 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 186 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE Sbjct: 50 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 91 >ref|XP_004961843.1| PREDICTED: histone H2B.2-like [Setaria italica] Length = 144 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 186 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE Sbjct: 55 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 96 >gb|EMT26655.1| Putative histone H2B.1 [Aegilops tauschii] Length = 145 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 186 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE Sbjct: 56 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 97 >gb|EMS49652.1| putative histone H2B.1 [Triticum urartu] Length = 149 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 186 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 311 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE Sbjct: 60 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE 101