BLASTX nr result
ID: Zingiber23_contig00013553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00013553 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350896.1| PREDICTED: cytochrome b-c1 complex subunit 8... 75 9e-12 gb|EMJ06281.1| hypothetical protein PRUPE_ppa014373mg [Prunus pe... 75 9e-12 ref|XP_004242473.1| PREDICTED: cytochrome b-c1 complex subunit 8... 75 9e-12 ref|XP_006344090.1| PREDICTED: cytochrome b-c1 complex subunit 8... 75 1e-11 sp|P46269.2|QCR8_SOLTU RecName: Full=Cytochrome b-c1 complex sub... 75 1e-11 ref|XP_002263013.1| PREDICTED: cytochrome b-c1 complex subunit 8... 74 2e-11 ref|XP_004240434.1| PREDICTED: cytochrome b-c1 complex subunit 8... 73 3e-11 gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] 73 4e-11 gb|EOY20209.1| Cytochrome b-c1 complex subunit 8 [Theobroma cacao] 73 4e-11 ref|XP_002319981.1| predicted protein [Populus trichocarpa] 72 6e-11 ref|XP_002325629.1| ubiquinol-cytochrome C reductase complex ubi... 72 8e-11 ref|XP_003519298.1| PREDICTED: cytochrome b-c1 complex subunit 8... 72 1e-10 gb|EMJ24638.1| hypothetical protein PRUPE_ppa014372mg [Prunus pe... 71 1e-10 ref|XP_003544945.1| PREDICTED: cytochrome b-c1 complex subunit 8... 71 1e-10 ref|XP_002533341.1| Ubiquinol-cytochrome c reductase complex ubi... 70 2e-10 gb|ADB02905.1| cytochrome b-c1 complex subunit 8 [Jatropha curcas] 70 3e-10 gb|ESW13993.1| hypothetical protein PHAVU_008G244100g [Phaseolus... 69 5e-10 ref|XP_006486127.1| PREDICTED: cytochrome b-c1 complex subunit 8... 69 6e-10 ref|XP_006435966.1| hypothetical protein CICLE_v10033444mg, part... 69 6e-10 ref|XP_006399001.1| hypothetical protein EUTSA_v10015196mg [Eutr... 69 6e-10 >ref|XP_006350896.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum tuberosum] Length = 72 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPLIGTYSYVQ++ EKEKLEHRY Sbjct: 36 HKVSENWISATLLLGPLIGTYSYVQHFLEKEKLEHRY 72 >gb|EMJ06281.1| hypothetical protein PRUPE_ppa014373mg [Prunus persica] Length = 72 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HK+SENWISATLLLGPL+G YSYVQ YQEKEKLEHRY Sbjct: 36 HKISENWISATLLLGPLVGVYSYVQSYQEKEKLEHRY 72 >ref|XP_004242473.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum lycopersicum] Length = 72 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPLIGTYSYVQ++ EKEKLEHRY Sbjct: 36 HKVSENWISATLLLGPLIGTYSYVQHFLEKEKLEHRY 72 >ref|XP_006344090.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum tuberosum] Length = 72 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+GTYSYVQ++ EKEKLEHRY Sbjct: 36 HKVSENWISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72 >sp|P46269.2|QCR8_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 8; AltName: Full=Complex III subunit 8; AltName: Full=Complex III subunit VII; AltName: Full=Ubiquinol-cytochrome c reductase complex 8.2 kDa protein; AltName: Full=Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C gi|633687|emb|CAA55862.1| ubiquinol--cytochrome c reductase [Solanum tuberosum] gi|1094912|prf||2107179A cytochrome c oxidase:SUBUNIT=8.2kD Length = 72 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+GTYSYVQ++ EKEKLEHRY Sbjct: 36 HKVSENWISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72 >ref|XP_002263013.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Vitis vinifera] gi|297737194|emb|CBI26395.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKV+ENWISATLLL PLIGTYSYVQ YQEKEKLEHRY Sbjct: 36 HKVTENWISATLLLAPLIGTYSYVQNYQEKEKLEHRY 72 >ref|XP_004240434.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Solanum lycopersicum] Length = 72 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+GTYSYVQ + EKEKLEHRY Sbjct: 36 HKVSENWISATLLLGPLVGTYSYVQNFLEKEKLEHRY 72 >gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] Length = 72 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENW+SATLLL PL+GTYSYV++YQEKEK+EHRY Sbjct: 36 HKVSENWLSATLLLTPLVGTYSYVKWYQEKEKMEHRY 72 >gb|EOY20209.1| Cytochrome b-c1 complex subunit 8 [Theobroma cacao] Length = 72 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKV+ENWISATLLLGPL+GTY+YVQ YQEKEKL HRY Sbjct: 36 HKVTENWISATLLLGPLVGTYTYVQNYQEKEKLAHRY 72 >ref|XP_002319981.1| predicted protein [Populus trichocarpa] Length = 72 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+G Y+YVQ YQEKEKL HRY Sbjct: 36 HKVSENWISATLLLGPLVGVYTYVQNYQEKEKLSHRY 72 >ref|XP_002325629.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding family protein [Populus trichocarpa] gi|118484575|gb|ABK94161.1| unknown [Populus trichocarpa] gi|118487047|gb|ABK95354.1| unknown [Populus trichocarpa] gi|222862504|gb|EEF00011.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding family protein [Populus trichocarpa] Length = 72 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLL PL+G Y+YVQ YQEKEKLEHRY Sbjct: 36 HKVSENWISATLLLAPLVGVYTYVQNYQEKEKLEHRY 72 >ref|XP_003519298.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Glycine max] Length = 72 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+GTY+YVQ Y EKEKL HRY Sbjct: 36 HKVSENWISATLLLGPLVGTYTYVQNYLEKEKLSHRY 72 >gb|EMJ24638.1| hypothetical protein PRUPE_ppa014372mg [Prunus persica] Length = 72 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENW+SATLLL PL+ TY+YVQ YQEKEKLEHRY Sbjct: 36 HKVSENWLSATLLLAPLVATYTYVQQYQEKEKLEHRY 72 >ref|XP_003544945.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Glycine max] Length = 72 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+GTY+YVQ Y EKEKL HRY Sbjct: 36 HKVSENWISATLLLGPLVGTYAYVQNYLEKEKLAHRY 72 >ref|XP_002533341.1| Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, putative [Ricinus communis] gi|223526821|gb|EEF29040.1| Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, putative [Ricinus communis] Length = 92 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHR 109 HKVSENWISATLLL PL+G YSYVQ YQEKEKLEHR Sbjct: 29 HKVSENWISATLLLAPLVGVYSYVQNYQEKEKLEHR 64 >gb|ADB02905.1| cytochrome b-c1 complex subunit 8 [Jatropha curcas] Length = 72 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLL PLIGTY++VQ YQEKEKLEHR+ Sbjct: 36 HKVSENWISATLLLTPLIGTYTHVQNYQEKEKLEHRF 72 >gb|ESW13993.1| hypothetical protein PHAVU_008G244100g [Phaseolus vulgaris] gi|561015133|gb|ESW13994.1| hypothetical protein PHAVU_008G244100g [Phaseolus vulgaris] Length = 72 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWISATLLLGPL+GTY+YVQ Y E EKL HRY Sbjct: 36 HKVSENWISATLLLGPLVGTYAYVQNYLEHEKLSHRY 72 >ref|XP_006486127.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Citrus sinensis] Length = 72 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVS+NWIS LLLGPL+GTY+YVQ YQEKEKL HRY Sbjct: 36 HKVSDNWISTILLLGPLVGTYAYVQNYQEKEKLAHRY 72 >ref|XP_006435966.1| hypothetical protein CICLE_v10033444mg, partial [Citrus clementina] gi|557538162|gb|ESR49206.1| hypothetical protein CICLE_v10033444mg, partial [Citrus clementina] Length = 94 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVS+NWIS LLLGPL+GTY+YVQ YQEKEKL HRY Sbjct: 58 HKVSDNWISTILLLGPLVGTYAYVQNYQEKEKLAHRY 94 >ref|XP_006399001.1| hypothetical protein EUTSA_v10015196mg [Eutrema salsugineum] gi|557100091|gb|ESQ40454.1| hypothetical protein EUTSA_v10015196mg [Eutrema salsugineum] Length = 72 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 2 HKVSENWISATLLLGPLIGTYSYVQYYQEKEKLEHRY 112 HKVSENWIS LLL P++GTYSY QYYQE+EKLEHR+ Sbjct: 36 HKVSENWISTILLLAPVVGTYSYAQYYQEQEKLEHRF 72