BLASTX nr result
ID: Zingiber23_contig00013083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00013083 (257 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65262.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis] 64 2e-08 dbj|BAJ99059.1| predicted protein [Hordeum vulgare subsp. vulgar... 59 7e-07 gb|ESW35419.1| hypothetical protein PHAVU_001G233700g [Phaseolus... 59 9e-07 ref|XP_002283100.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 59 9e-07 ref|XP_003537459.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 58 1e-06 gb|AAK73147.1|AC079022_20 putative RING-H2 finger protein [Oryza... 57 2e-06 gb|EPS68566.1| hypothetical protein M569_06199, partial [Genlise... 57 2e-06 ref|XP_002439130.1| hypothetical protein SORBIDRAFT_09g001100 [S... 57 2e-06 ref|XP_002531557.1| zinc finger protein, putative [Ricinus commu... 56 4e-06 gb|EPS71485.1| hypothetical protein M569_03274 [Genlisea aurea] 56 6e-06 ref|XP_004503159.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 56 6e-06 gb|AFW88842.1| putative RING zinc finger domain superfamily prot... 56 6e-06 ref|XP_002468111.1| hypothetical protein SORBIDRAFT_01g039760 [S... 56 6e-06 gb|ACG48803.1| protein binding protein [Zea mays] 56 6e-06 ref|NP_001136765.1| uncharacterized LOC100216907 [Zea mays] gi|1... 56 6e-06 gb|EAY89422.1| hypothetical protein OsI_10929 [Oryza sativa Indi... 56 6e-06 ref|NP_001049693.1| Os03g0271600 [Oryza sativa Japonica Group] g... 56 6e-06 ref|XP_004984935.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 55 9e-06 ref|XP_004960533.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 55 9e-06 dbj|BAJ87816.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 9e-06 >gb|EXB65262.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis] Length = 390 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPPP 25 YWCY+CSRFVRV + A+VC DC GGF+EE+ PP P Sbjct: 8 YWCYRCSRFVRVWNDDAVVCPDCDGGFVEEIENPPQP 44 >dbj|BAJ99059.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326502908|dbj|BAJ99082.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326530360|dbj|BAJ97606.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 280 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPPP 25 YWCY CSRFVRV + +VC DC GGFLE+ PPPP Sbjct: 8 YWCYHCSRFVRV-SPATVVCPDCDGGFLEQFPQPPPP 43 >gb|ESW35419.1| hypothetical protein PHAVU_001G233700g [Phaseolus vulgaris] Length = 386 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPP 31 YWCY+CSRF+RV + A+VC DC GF+EE+ PP Sbjct: 9 YWCYRCSRFIRVLRHDAVVCPDCDSGFIEEIEHPP 43 >ref|XP_002283100.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera] Length = 361 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPPPP 22 YWCY C+RFVRV AIVC DC GGFLEE+ P P Sbjct: 3 YWCYSCNRFVRVWSHDAIVCPDCDGGFLEEIEEQPRRP 40 >ref|XP_003537459.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max] Length = 393 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPP 31 YWCY+CSRFVRV +VC DC GGF+EE+ PP Sbjct: 10 YWCYRCSRFVRVWPHHTVVCPDCDGGFIEEIEHPP 44 >gb|AAK73147.1|AC079022_20 putative RING-H2 finger protein [Oryza sativa] Length = 386 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = -3 Query: 135 YWCYQCSRFVRV---RQESAIVCSDCHGGFLEEVGTPPP 28 YWCY C RFVR +SA+ C DC GGFLEE+ PPP Sbjct: 21 YWCYSCDRFVRAPAPHDDSAVACPDCGGGFLEEMSAPPP 59 >gb|EPS68566.1| hypothetical protein M569_06199, partial [Genlisea aurea] Length = 385 Score = 57.0 bits (136), Expect = 2e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTP 34 YWCY+CSRFVRV + ++ C DC GGF+EEV P Sbjct: 7 YWCYRCSRFVRVWNQDSVACPDCDGGFVEEVDAP 40 >ref|XP_002439130.1| hypothetical protein SORBIDRAFT_09g001100 [Sorghum bicolor] gi|241944415|gb|EES17560.1| hypothetical protein SORBIDRAFT_09g001100 [Sorghum bicolor] Length = 413 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAI-VCSDCHGGFLEEVGTPPPP 25 YWCYQC RFVR A C C GGFLEE+G PPPP Sbjct: 20 YWCYQCDRFVRATAAPASPACPSCGGGFLEEMGAPPPP 57 >ref|XP_002531557.1| zinc finger protein, putative [Ricinus communis] gi|223528818|gb|EEF30823.1| zinc finger protein, putative [Ricinus communis] Length = 356 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = -3 Query: 135 YWCYQCSRFVRVRQES---AIVCSDCHGGFLEEVGTPPPPP 22 +WCY+C+RF+RVR S +I C DC GGF+EE+GTP P Sbjct: 10 FWCYRCNRFIRVRVPSIQDSISCPDCGGGFIEEIGTPSHSP 50 >gb|EPS71485.1| hypothetical protein M569_03274 [Genlisea aurea] Length = 420 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGT 37 YWCY+CSRFVRV + +I C DC GGF+EE+ T Sbjct: 5 YWCYRCSRFVRVWTQDSIACPDCDGGFVEEIDT 37 >ref|XP_004503159.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cicer arietinum] Length = 380 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTP 34 YWCY+CSRFVRV ++ + C DC GGF+EE+ P Sbjct: 9 YWCYRCSRFVRVGRQETVTCPDCDGGFVEEIEHP 42 >gb|AFW88842.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 278 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY CSRFVRV S +VC +C GGFLE+ PPP Sbjct: 8 YWCYSCSRFVRV-SPSTVVCPECDGGFLEQFTQPPP 42 >ref|XP_002468111.1| hypothetical protein SORBIDRAFT_01g039760 [Sorghum bicolor] gi|241921965|gb|EER95109.1| hypothetical protein SORBIDRAFT_01g039760 [Sorghum bicolor] Length = 275 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY CSRFVRV S +VC +C GGFLE+ PPP Sbjct: 8 YWCYSCSRFVRV-SPSTVVCPECDGGFLEQFTQPPP 42 >gb|ACG48803.1| protein binding protein [Zea mays] Length = 278 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY CSRFVRV S +VC +C GGFLE+ PPP Sbjct: 8 YWCYSCSRFVRV-SPSTVVCPECDGGFLEQFTQPPP 42 >ref|NP_001136765.1| uncharacterized LOC100216907 [Zea mays] gi|194696968|gb|ACF82568.1| unknown [Zea mays] gi|414866063|tpg|DAA44620.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Length = 278 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY CSRFVRV S +VC +C GGFLE+ PPP Sbjct: 8 YWCYSCSRFVRV-SPSTVVCPECDGGFLEQFTQPPP 42 >gb|EAY89422.1| hypothetical protein OsI_10929 [Oryza sativa Indica Group] Length = 279 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY CSRFVRV S +VC +C GGFLE+ PPP Sbjct: 8 YWCYHCSRFVRV-SPSTVVCPECDGGFLEQFPQPPP 42 >ref|NP_001049693.1| Os03g0271600 [Oryza sativa Japonica Group] gi|29893617|gb|AAP06871.1| unknown protein [Oryza sativa Japonica Group] gi|108707422|gb|ABF95217.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa Japonica Group] gi|113548164|dbj|BAF11607.1| Os03g0271600 [Oryza sativa Japonica Group] gi|215695129|dbj|BAG90320.1| unnamed protein product [Oryza sativa Japonica Group] Length = 279 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY CSRFVRV S +VC +C GGFLE+ PPP Sbjct: 8 YWCYHCSRFVRV-SPSTVVCPECDGGFLEQFPQPPP 42 >ref|XP_004984935.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica] Length = 277 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY+CSRFVRV + +VC +C GGFLE+ PPP Sbjct: 8 YWCYRCSRFVRV-SPATVVCPECDGGFLEQFPQPPP 42 >ref|XP_004960533.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica] Length = 410 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 12/48 (25%) Frame = -3 Query: 135 YWCYQCSRFVRVRQE------------SAIVCSDCHGGFLEEVGTPPP 28 YWCYQC RFVR E +A+ C C GGFLEE+G PPP Sbjct: 13 YWCYQCDRFVRATAEGGDGSSPPAAAAAAVACPSCGGGFLEEMGAPPP 60 >dbj|BAJ87816.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 396 Score = 55.1 bits (131), Expect = 9e-06 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -3 Query: 135 YWCYQCSRFVRVRQESAIVCSDCHGGFLEEVGTPPP 28 YWCY C RFVR ++ + C C GGFLE++ PPP Sbjct: 20 YWCYSCERFVRTEGDAGLACPGCDGGFLEQMDAPPP 55