BLASTX nr result
ID: Zingiber23_contig00013058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00013058 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443751.1| hypothetical protein SORBIDRAFT_07g001340 [S... 67 2e-09 gb|AFW74319.1| hypothetical protein ZEAMMB73_826417 [Zea mays] 67 2e-09 ref|NP_001141358.1| uncharacterized protein LOC100273449 [Zea ma... 67 2e-09 ref|XP_002960123.1| ubiquitin-protein ligase, PUB61 [Selaginella... 67 3e-09 ref|XP_002984018.1| ubiquitin-protein ligase, PUB61 [Selaginella... 67 3e-09 dbj|BAD09517.1| unknown protein [Oryza sativa Japonica Group] gi... 65 7e-09 gb|EEE67929.1| hypothetical protein OsJ_25805 [Oryza sativa Japo... 65 7e-09 gb|EEC82805.1| hypothetical protein OsI_27581 [Oryza sativa Indi... 65 7e-09 ref|XP_006352665.1| PREDICTED: E3 ubiquitin-protein ligase CHIP-... 64 2e-08 ref|XP_006836948.1| hypothetical protein AMTR_s00099p00158360 [A... 64 2e-08 gb|EXB84497.1| E3 ubiquitin-protein ligase CHIP [Morus notabilis] 63 4e-08 ref|XP_004242428.1| PREDICTED: E3 ubiquitin-protein ligase CHIP-... 63 5e-08 ref|XP_003626894.1| E3 ubiquitin-protein ligase CHIP [Medicago t... 63 5e-08 ref|XP_003626893.1| E3 ubiquitin-protein ligase CHIP [Medicago t... 63 5e-08 gb|ACJ84501.1| unknown [Medicago truncatula] gi|388515481|gb|AFK... 63 5e-08 gb|ADE76424.1| unknown [Picea sitchensis] 62 6e-08 ref|XP_002533498.1| heat shock protein 70 (HSP70)-interacting pr... 62 1e-07 gb|ESW06231.1| hypothetical protein PHAVU_010G029900g [Phaseolus... 61 1e-07 gb|ESW06230.1| hypothetical protein PHAVU_010G029900g [Phaseolus... 61 1e-07 ref|XP_004973030.1| PREDICTED: E3 ubiquitin-protein ligase CHIP-... 61 1e-07 >ref|XP_002443751.1| hypothetical protein SORBIDRAFT_07g001340 [Sorghum bicolor] gi|241940101|gb|EES13246.1| hypothetical protein SORBIDRAFT_07g001340 [Sorghum bicolor] Length = 275 Score = 67.4 bits (163), Expect = 2e-09 Identities = 36/62 (58%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 168 MALAASD-------QAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICY 10 MA AA D QA+LL + G AF K+R AAI+AYT AITLCP VA Y+ NRA+CY Sbjct: 1 MAPAAPDGGAESQRQADLLKQEGNAFFRKERLSAAIDAYTGAITLCPNVAVYWTNRALCY 60 Query: 9 RK 4 RK Sbjct: 61 RK 62 >gb|AFW74319.1| hypothetical protein ZEAMMB73_826417 [Zea mays] Length = 157 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -1 Query: 147 QAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 QA+LL + G AF K+R AAI+AYT AITLCP VA Y+ NRA+CYRK Sbjct: 15 QADLLKQEGNAFFRKERLSAAIDAYTGAITLCPNVAVYWTNRALCYRK 62 >ref|NP_001141358.1| uncharacterized protein LOC100273449 [Zea mays] gi|194704148|gb|ACF86158.1| unknown [Zea mays] gi|195648362|gb|ACG43649.1| STIP1 homology and U box-containing protein 1 [Zea mays] gi|413941669|gb|AFW74318.1| STIP1 y and U box-containing protein 1 [Zea mays] Length = 275 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -1 Query: 147 QAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 QA+LL + G AF K+R AAI+AYT AITLCP VA Y+ NRA+CYRK Sbjct: 15 QADLLKQEGNAFFRKERLSAAIDAYTGAITLCPNVAVYWTNRALCYRK 62 >ref|XP_002960123.1| ubiquitin-protein ligase, PUB61 [Selaginella moellendorffii] gi|300171062|gb|EFJ37662.1| ubiquitin-protein ligase, PUB61 [Selaginella moellendorffii] Length = 281 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = -1 Query: 171 AMALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 A ++A+ QAELL E G + K+R AAI+AYTEAITLCP V Y+ NRA+CY++ Sbjct: 3 AKIVSAAKQAELLKEQGNLYFKKERLSAAIDAYTEAITLCPDVPVYWTNRALCYQR 58 >ref|XP_002984018.1| ubiquitin-protein ligase, PUB61 [Selaginella moellendorffii] gi|300148370|gb|EFJ15030.1| ubiquitin-protein ligase, PUB61 [Selaginella moellendorffii] Length = 281 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = -1 Query: 171 AMALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 A ++A+ QAELL E G + K+R AAI+AYTEAITLCP V Y+ NRA+CY++ Sbjct: 3 AKIVSAAKQAELLKEQGNLYFKKERLSAAIDAYTEAITLCPDVPVYWTNRALCYQR 58 >dbj|BAD09517.1| unknown protein [Oryza sativa Japonica Group] gi|42409284|dbj|BAD10546.1| unknown protein [Oryza sativa Japonica Group] gi|215741255|dbj|BAG97750.1| unnamed protein product [Oryza sativa Japonica Group] Length = 212 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -1 Query: 171 AMALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 A + A+ QAELL + G AF K R AAI+AYT AI LCP+VA Y+ NRA+CY++ Sbjct: 5 ADSAASKRQAELLKQEGNAFFKKDRISAAIDAYTGAIALCPKVAVYWTNRALCYKR 60 >gb|EEE67929.1| hypothetical protein OsJ_25805 [Oryza sativa Japonica Group] Length = 273 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -1 Query: 171 AMALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 A + A+ QAELL + G AF K R AAI+AYT AI LCP+VA Y+ NRA+CY++ Sbjct: 5 ADSAASKRQAELLKQEGNAFFKKDRISAAIDAYTGAIALCPKVAVYWTNRALCYKR 60 >gb|EEC82805.1| hypothetical protein OsI_27581 [Oryza sativa Indica Group] Length = 273 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -1 Query: 171 AMALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 A + A+ QAELL + G AF K R AAI+AYT AI LCP+VA Y+ NRA+CY++ Sbjct: 5 ADSAASKRQAELLKQEGNAFFKKDRISAAIDAYTGAIALCPKVAVYWTNRALCYKR 60 >ref|XP_006352665.1| PREDICTED: E3 ubiquitin-protein ligase CHIP-like [Solanum tuberosum] Length = 277 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = -1 Query: 165 ALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 ++ S QAE L + G + K RF AAI+AYTEAITLCP V Y+ NRA+C+RK Sbjct: 3 SIVGSKQAEQLKQDGNHYFQKNRFGAAIDAYTEAITLCPNVPIYWTNRALCHRK 56 >ref|XP_006836948.1| hypothetical protein AMTR_s00099p00158360 [Amborella trichopoda] gi|548839512|gb|ERM99801.1| hypothetical protein AMTR_s00099p00158360 [Amborella trichopoda] Length = 221 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 + + QAELL + G F K R AAI+AYTEAITLCP V Y+ NRA+C+RK Sbjct: 7 SVAKQAELLKQDGNTFFKKDRLGAAIDAYTEAITLCPNVPVYWTNRALCHRK 58 >gb|EXB84497.1| E3 ubiquitin-protein ligase CHIP [Morus notabilis] Length = 147 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = -1 Query: 171 AMALAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 ++AL+ +QAE L + G + K RF AAIEAYTEAITLCP V Y+ NRA C+ K Sbjct: 4 SVALSWQEQAEQLRKDGNHYFKKDRFRAAIEAYTEAITLCPNVPVYFTNRARCHLK 59 >ref|XP_004242428.1| PREDICTED: E3 ubiquitin-protein ligase CHIP-like [Solanum lycopersicum] Length = 276 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -1 Query: 162 LAASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 + S QAE L + G + K RF AAI+AYTEAITLCP V Y+ NRA+C+R+ Sbjct: 4 IVGSKQAEQLKQDGNNYFQKNRFGAAIDAYTEAITLCPNVPIYWTNRALCHRR 56 >ref|XP_003626894.1| E3 ubiquitin-protein ligase CHIP [Medicago truncatula] gi|355520916|gb|AET01370.1| E3 ubiquitin-protein ligase CHIP [Medicago truncatula] Length = 288 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 +A QAELL G + K RF AAI+AYTEAITLCP V Y+ NRA+C+ K Sbjct: 6 SAMRQAELLRNDGNNYFKKNRFNAAIDAYTEAITLCPNVPVYFTNRALCHLK 57 >ref|XP_003626893.1| E3 ubiquitin-protein ligase CHIP [Medicago truncatula] gi|355520915|gb|AET01369.1| E3 ubiquitin-protein ligase CHIP [Medicago truncatula] Length = 277 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 +A QAELL G + K RF AAI+AYTEAITLCP V Y+ NRA+C+ K Sbjct: 6 SAMRQAELLRNDGNNYFKKNRFNAAIDAYTEAITLCPNVPVYFTNRALCHLK 57 >gb|ACJ84501.1| unknown [Medicago truncatula] gi|388515481|gb|AFK45802.1| unknown [Medicago truncatula] Length = 277 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 +A QAELL G + K RF AAI+AYTEAITLCP V Y+ NRA+C+ K Sbjct: 6 SAMRQAELLRNDGNNYFKKNRFNAAIDAYTEAITLCPNVPVYFTNRALCHLK 57 >gb|ADE76424.1| unknown [Picea sitchensis] Length = 320 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -1 Query: 147 QAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 QAE+L + G + K R AAIEAYT+AITLCP V Y+ NRA+C+RK Sbjct: 14 QAEILKQDGNTYFKKDRLGAAIEAYTQAITLCPNVTVYWTNRALCHRK 61 >ref|XP_002533498.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526642|gb|EEF28885.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 279 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 AA QAE L G + + RF AAI+AYTEAITLCP V Y+ NRA+C+RK Sbjct: 5 AAFKQAEKLRIDGNTYFKRDRFGAAIDAYTEAITLCPNVPVYWTNRALCHRK 56 >gb|ESW06231.1| hypothetical protein PHAVU_010G029900g [Phaseolus vulgaris] Length = 278 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 AA+ QAE L +G + K RF AAI+AYTEAITLCP V Y+ NRA+C+ K Sbjct: 6 AAAKQAEKLRINGNTYFKKDRFGAAIDAYTEAITLCPNVPIYWTNRALCHLK 57 >gb|ESW06230.1| hypothetical protein PHAVU_010G029900g [Phaseolus vulgaris] Length = 276 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 159 AASDQAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 AA+ QAE L +G + K RF AAI+AYTEAITLCP V Y+ NRA+C+ K Sbjct: 6 AAAKQAEKLRINGNTYFKKDRFGAAIDAYTEAITLCPNVPIYWTNRALCHLK 57 >ref|XP_004973030.1| PREDICTED: E3 ubiquitin-protein ligase CHIP-like [Setaria italica] Length = 275 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -1 Query: 147 QAELLNESGKAFVGKKRFLAAIEAYTEAITLCPRVAKYYANRAICYRK 4 QA+ L + G A K+R AAI+AYT AITLCP VA Y+ NRA+CY+K Sbjct: 15 QADRLKQEGNALFRKERLSAAIDAYTGAITLCPNVAVYWTNRALCYKK 62