BLASTX nr result
ID: Zingiber23_contig00012137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00012137 (726 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ02979.1| hypothetical protein PRUPE_ppa000010mg [Prunus pe... 93 1e-16 ref|XP_002520949.1| conserved hypothetical protein [Ricinus comm... 93 1e-16 gb|EOX94628.1| Beige/BEACH domain,WD domain, G-beta repeat prote... 92 2e-16 ref|XP_006479640.1| PREDICTED: WD repeat and FYVE domain-contain... 91 3e-16 ref|XP_006479639.1| PREDICTED: WD repeat and FYVE domain-contain... 91 3e-16 ref|XP_006479638.1| PREDICTED: WD repeat and FYVE domain-contain... 91 3e-16 ref|XP_006443969.1| hypothetical protein CICLE_v100184262mg, par... 91 3e-16 gb|AAD25803.1|AC006550_11 Similar to gb|U70015 lysosomal traffic... 91 3e-16 ref|NP_171805.1| WD/BEACH domain protein SPIRRIG [Arabidopsis th... 91 3e-16 ref|XP_002892146.1| hypothetical protein ARALYDRAFT_311407 [Arab... 91 3e-16 ref|XP_006386255.1| hypothetical protein POPTR_0002s04860g [Popu... 89 1e-15 ref|XP_002302086.1| predicted protein [Populus trichocarpa] 89 1e-15 ref|XP_006418270.1| hypothetical protein EUTSA_v10006519mg [Eutr... 89 2e-15 ref|XP_006418269.1| hypothetical protein EUTSA_v10006519mg [Eutr... 89 2e-15 ref|XP_006383677.1| hypothetical protein POPTR_0005s23680g [Popu... 89 2e-15 ref|XP_002306800.1| predicted protein [Populus trichocarpa] 89 2e-15 ref|XP_006306566.1| hypothetical protein CARUB_v10008059mg [Caps... 88 2e-15 ref|XP_004247202.1| PREDICTED: BEACH domain-containing protein l... 87 7e-15 ref|XP_006349729.1| PREDICTED: BEACH domain-containing protein l... 86 1e-14 ref|XP_003590569.1| WD repeat and FYVE domain-containing protein... 86 1e-14 >gb|EMJ02979.1| hypothetical protein PRUPE_ppa000010mg [Prunus persica] Length = 3493 Score = 92.8 bits (229), Expect = 1e-16 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLKSHKHPVT+LH+T+DLKQ+LSGDS G LLSWT+PD+SL+A Sbjct: 3438 PEYRLVLHKVLKSHKHPVTSLHLTNDLKQLLSGDSGGHLLSWTVPDESLRA 3488 >ref|XP_002520949.1| conserved hypothetical protein [Ricinus communis] gi|223539786|gb|EEF41366.1| conserved hypothetical protein [Ricinus communis] Length = 3591 Score = 92.8 bits (229), Expect = 1e-16 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILH+VLKSHKHPVTALH+TSDLKQ+LSGDS G LLSWT+PD++L+A Sbjct: 3536 PEYRLILHRVLKSHKHPVTALHLTSDLKQLLSGDSGGHLLSWTLPDETLRA 3586 >gb|EOX94628.1| Beige/BEACH domain,WD domain, G-beta repeat protein [Theobroma cacao] Length = 3597 Score = 91.7 bits (226), Expect = 2e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVTALH+TSDLKQ+LSGDS G L+SWT+PD+SL+A Sbjct: 3542 PEYRLVLHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLISWTLPDESLRA 3592 >ref|XP_006479640.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like isoform X3 [Citrus sinensis] Length = 3576 Score = 91.3 bits (225), Expect = 3e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVTALH+TSDLKQ+LSGDS G L+SWT+PD+SL+A Sbjct: 3521 PEYRLVLHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLVSWTLPDESLRA 3571 >ref|XP_006479639.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like isoform X2 [Citrus sinensis] Length = 3609 Score = 91.3 bits (225), Expect = 3e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVTALH+TSDLKQ+LSGDS G L+SWT+PD+SL+A Sbjct: 3554 PEYRLVLHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLVSWTLPDESLRA 3604 >ref|XP_006479638.1| PREDICTED: WD repeat and FYVE domain-containing protein 3-like isoform X1 [Citrus sinensis] Length = 3610 Score = 91.3 bits (225), Expect = 3e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVTALH+TSDLKQ+LSGDS G L+SWT+PD+SL+A Sbjct: 3555 PEYRLVLHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLVSWTLPDESLRA 3605 >ref|XP_006443969.1| hypothetical protein CICLE_v100184262mg, partial [Citrus clementina] gi|557546231|gb|ESR57209.1| hypothetical protein CICLE_v100184262mg, partial [Citrus clementina] Length = 2217 Score = 91.3 bits (225), Expect = 3e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVTALH+TSDLKQ+LSGDS G L+SWT+PD+SL+A Sbjct: 2162 PEYRLVLHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLVSWTLPDESLRA 2212 >gb|AAD25803.1|AC006550_11 Similar to gb|U70015 lysosomal trafficking regulator from Mus musculus and contains 2 PF|00400 WD40, G-beta repeats. ESTs gb|T43386 and gb|AA395236 come from this gene [Arabidopsis thaliana] Length = 3600 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HK PVTALH+TSDLKQ+LSGDS+GQLLSWT+PD++L+A Sbjct: 3527 PEYKLILHKVLKFHKQPVTALHLTSDLKQLLSGDSAGQLLSWTVPDETLRA 3577 >ref|NP_171805.1| WD/BEACH domain protein SPIRRIG [Arabidopsis thaliana] gi|332189402|gb|AEE27523.1| WD/BEACH domain protein SPIRRIG [Arabidopsis thaliana] Length = 3601 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HK PVTALH+TSDLKQ+LSGDS+GQLLSWT+PD++L+A Sbjct: 3528 PEYKLILHKVLKFHKQPVTALHLTSDLKQLLSGDSAGQLLSWTVPDETLRA 3578 >ref|XP_002892146.1| hypothetical protein ARALYDRAFT_311407 [Arabidopsis lyrata subsp. lyrata] gi|297337988|gb|EFH68405.1| hypothetical protein ARALYDRAFT_311407 [Arabidopsis lyrata subsp. lyrata] Length = 3606 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HK PVTALH+TSDLKQ+LSGDS+GQLLSWT+PD++L+A Sbjct: 3533 PEYKLILHKVLKFHKQPVTALHLTSDLKQLLSGDSAGQLLSWTVPDETLRA 3583 >ref|XP_006386255.1| hypothetical protein POPTR_0002s04860g [Populus trichocarpa] gi|550344297|gb|ERP64052.1| hypothetical protein POPTR_0002s04860g [Populus trichocarpa] Length = 3419 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVT+LH+TSDLKQ+LSGDS G LLSWT+PD SL A Sbjct: 3364 PEYRLLLHKVLKFHKHPVTSLHLTSDLKQLLSGDSGGHLLSWTLPDQSLMA 3414 >ref|XP_002302086.1| predicted protein [Populus trichocarpa] Length = 365 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY L+LHKVLK HKHPVT+LH+TSDLKQ+LSGDS G LLSWT+PD SL A Sbjct: 310 PEYRLLLHKVLKFHKHPVTSLHLTSDLKQLLSGDSGGHLLSWTLPDQSLMA 360 >ref|XP_006418270.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum] gi|557096041|gb|ESQ36623.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum] Length = 3601 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HK PVTAL++TSDLKQ+LSGDS+GQLLSWT+PD++L+A Sbjct: 3535 PEYKLILHKVLKFHKQPVTALYLTSDLKQLLSGDSAGQLLSWTLPDETLRA 3585 >ref|XP_006418269.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum] gi|557096040|gb|ESQ36622.1| hypothetical protein EUTSA_v10006519mg [Eutrema salsugineum] Length = 3572 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HK PVTAL++TSDLKQ+LSGDS+GQLLSWT+PD++L+A Sbjct: 3506 PEYKLILHKVLKFHKQPVTALYLTSDLKQLLSGDSAGQLLSWTLPDETLRA 3556 >ref|XP_006383677.1| hypothetical protein POPTR_0005s23680g [Populus trichocarpa] gi|550339616|gb|ERP61474.1| hypothetical protein POPTR_0005s23680g [Populus trichocarpa] Length = 3545 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSL 580 PEY L+LHKVLK HKHPVT+LH+TSDLKQ+LSGDS G LLSWT+PD+SL Sbjct: 3490 PEYRLLLHKVLKFHKHPVTSLHLTSDLKQLLSGDSGGHLLSWTLPDESL 3538 >ref|XP_002306800.1| predicted protein [Populus trichocarpa] Length = 603 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSL 580 PEY L+LHKVLK HKHPVT+LH+TSDLKQ+LSGDS G LLSWT+PD+SL Sbjct: 548 PEYRLLLHKVLKFHKHPVTSLHLTSDLKQLLSGDSGGHLLSWTLPDESL 596 >ref|XP_006306566.1| hypothetical protein CARUB_v10008059mg [Capsella rubella] gi|565497856|ref|XP_006306567.1| hypothetical protein CARUB_v10008059mg [Capsella rubella] gi|482575277|gb|EOA39464.1| hypothetical protein CARUB_v10008059mg [Capsella rubella] gi|482575278|gb|EOA39465.1| hypothetical protein CARUB_v10008059mg [Capsella rubella] Length = 3594 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/51 (76%), Positives = 48/51 (94%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HK P+TAL++TSDLKQ+LSGDS+GQLLSWT+PD++L+A Sbjct: 3528 PEYKLILHKVLKFHKQPITALYLTSDLKQLLSGDSAGQLLSWTLPDETLRA 3578 >ref|XP_004247202.1| PREDICTED: BEACH domain-containing protein lvsA-like [Solanum lycopersicum] Length = 3587 Score = 86.7 bits (213), Expect = 7e-15 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HKHPVTALH+TSDLKQ+LSGDS G LLSWT+ ++ LK+ Sbjct: 3532 PEYRLILHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLLSWTLSEEGLKS 3582 >ref|XP_006349729.1| PREDICTED: BEACH domain-containing protein lvsA-like [Solanum tuberosum] Length = 3590 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLKA 574 PEY LILHKVLK HKHPVTALH+TSDLKQ+LSGDS G LLSWT+ ++ +K+ Sbjct: 3535 PEYRLILHKVLKFHKHPVTALHLTSDLKQLLSGDSGGHLLSWTLSEEGMKS 3585 >ref|XP_003590569.1| WD repeat and FYVE domain-containing protein [Medicago truncatula] gi|355479617|gb|AES60820.1| WD repeat and FYVE domain-containing protein [Medicago truncatula] Length = 3617 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -1 Query: 726 PEYNLILHKVLKSHKHPVTALHVTSDLKQMLSGDSSGQLLSWTIPDDSLK 577 PEY LIL KVLK HKHPVTALH+T DLKQ+LSGDS G LLSWT+PD+SL+ Sbjct: 3562 PEYRLILRKVLKFHKHPVTALHLTIDLKQLLSGDSGGHLLSWTLPDESLR 3611