BLASTX nr result
ID: Zingiber23_contig00011823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00011823 (247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX96861.1| RNA-binding (RRM/RBD/RNP motifs) family protein, ... 55 7e-06 gb|EXB66987.1| Glycine-rich RNA-binding protein 2 [Morus notabilis] 55 1e-05 >gb|EOX96861.1| RNA-binding (RRM/RBD/RNP motifs) family protein, putative [Theobroma cacao] Length = 147 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 119 PLASRIFVRNLPYSTGEATLIKLFSKFGQIVEIKLAREE 3 PLASRIFVRNLPY+T E++L K F+ FGQI E+KL +++ Sbjct: 34 PLASRIFVRNLPYTTKESSLQKEFANFGQIAEVKLVKDD 72 >gb|EXB66987.1| Glycine-rich RNA-binding protein 2 [Morus notabilis] Length = 157 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 119 PLASRIFVRNLPYSTGEATLIKLFSKFGQIVEIKLAREE 3 PLASRI VRNLPYST E +L++ FS FGQI E+KL +++ Sbjct: 44 PLASRIIVRNLPYSTSERSLLENFSNFGQIAEVKLIKDK 82