BLASTX nr result
ID: Zingiber23_contig00011680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00011680 (200 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g... 70 3e-10 ref|XP_002532938.1| nucleic acid binding protein, putative [Rici... 69 8e-10 dbj|BAJ88160.1| predicted protein [Hordeum vulgare subsp. vulgare] 68 1e-09 ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [A... 67 2e-09 gb|ACG35732.1| nucleic acid binding protein [Zea mays] 67 2e-09 ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g... 67 2e-09 ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g... 67 2e-09 ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g... 67 2e-09 ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g... 67 2e-09 ref|NP_001141163.1| uncharacterized protein LOC100273249 [Zea ma... 67 2e-09 ref|XP_003570477.1| PREDICTED: KH domain-containing protein At5g... 67 3e-09 ref|XP_002454368.1| hypothetical protein SORBIDRAFT_04g029520 [S... 67 3e-09 ref|XP_004953739.1| PREDICTED: KH domain-containing protein At5g... 65 1e-08 gb|AFW63660.1| hypothetical protein ZEAMMB73_233372 [Zea mays] 64 2e-08 gb|ACN35020.1| unknown [Zea mays] gi|413923729|gb|AFW63661.1| hy... 64 2e-08 gb|EAY87341.1| hypothetical protein OsI_08744 [Oryza sativa Indi... 64 2e-08 ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g... 64 3e-08 ref|XP_006452750.1| hypothetical protein CICLE_v10009077mg [Citr... 64 3e-08 ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citr... 64 3e-08 ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g... 62 6e-08 >ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 isoform 1 [Vitis vinifera] gi|296089986|emb|CBI39805.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/66 (56%), Positives = 45/66 (68%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY + +R+A AL EQEKYL+EL AE+ KL+PF+ VLPHSY LL+Q Sbjct: 6 YMAYSPSPSTAPHSPHIAGLRSATSALVEQEKYLSELLAERHKLSPFMPVLPHSYRLLNQ 65 Query: 18 EILRVT 1 EILRVT Sbjct: 66 EILRVT 71 >ref|XP_002532938.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527289|gb|EEF29442.1| nucleic acid binding protein, putative [Ricinus communis] Length = 300 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A AL EQEKYL+EL AE+ KL+PF+ VLPH+Y LLSQEILRVT Sbjct: 35 LRSASSALVEQEKYLSELLAERHKLSPFMPVLPHTYRLLSQEILRVT 81 >dbj|BAJ88160.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 287 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/66 (54%), Positives = 43/66 (65%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY S +R + A+ +QEKYLAEL AE+ KLNPFV VLPHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRISGLRASSAAVADQEKYLAELLAERHKLNPFVPVLPHSIRLLNQ 65 Query: 18 EILRVT 1 EILRV+ Sbjct: 66 EILRVS 71 >ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda] gi|548861697|gb|ERN19068.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda] Length = 286 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -3 Query: 138 RTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 R+A AL EQ+KYL+EL AE+QKL PF+QVLPHSY +L+QEI+RVT Sbjct: 22 RSAATALVEQDKYLSELLAERQKLGPFMQVLPHSYRVLNQEIVRVT 67 >gb|ACG35732.1| nucleic acid binding protein [Zea mays] Length = 286 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/66 (53%), Positives = 42/66 (63%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY + +R A+ EQEKYLAEL AE+QKL PFV V+PHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIAGLRAPSAAMAEQEKYLAELLAERQKLGPFVPVIPHSVRLLNQ 65 Query: 18 EILRVT 1 EILRV+ Sbjct: 66 EILRVS 71 >ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g56140-like isoform X2 [Solanum tuberosum] Length = 289 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ EQEKYL+EL AE+ KL PFV VLPH Y LL+QE+LRVT Sbjct: 24 LRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYRLLNQELLRVT 70 >ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g56140-like isoform X1 [Solanum tuberosum] Length = 293 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ EQEKYL+EL AE+ KL PFV VLPH Y LL+QE+LRVT Sbjct: 24 LRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYRLLNQELLRVT 70 >ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 2 [Solanum lycopersicum] Length = 295 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ EQEKYL+EL AE+ KL PFV VLPH Y LL+QE+LRVT Sbjct: 24 LRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYRLLNQELLRVT 70 >ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 1 [Solanum lycopersicum] Length = 299 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ EQEKYL+EL AE+ KL PFV VLPH Y LL+QE+LRVT Sbjct: 24 LRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYRLLNQELLRVT 70 >ref|NP_001141163.1| uncharacterized protein LOC100273249 [Zea mays] gi|194703026|gb|ACF85597.1| unknown [Zea mays] gi|413938647|gb|AFW73198.1| nucleic acid binding protein [Zea mays] Length = 286 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/66 (53%), Positives = 42/66 (63%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY + +R A+ EQEKYLAEL AE+QKL PFV V+PHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIAGLRAPSAAVAEQEKYLAELLAERQKLGPFVPVIPHSVRLLNQ 65 Query: 18 EILRVT 1 EILRV+ Sbjct: 66 EILRVS 71 >ref|XP_003570477.1| PREDICTED: KH domain-containing protein At5g56140-like [Brachypodium distachyon] Length = 283 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/66 (53%), Positives = 43/66 (65%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY S +R + A+ +QEKYL+EL AE+ KLNPFV VLPHS LL+Q Sbjct: 3 YMAYSPSPSTTPHSPRISGLRASSAAVADQEKYLSELLAERHKLNPFVPVLPHSIRLLNQ 62 Query: 18 EILRVT 1 EILRV+ Sbjct: 63 EILRVS 68 >ref|XP_002454368.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor] gi|241934199|gb|EES07344.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor] Length = 286 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/66 (51%), Positives = 41/66 (62%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY +RT A+ EQEKYLAEL AE+ KL PF+ V+PHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIGGLRTPSAAVAEQEKYLAELLAERHKLGPFIPVIPHSVRLLNQ 65 Query: 18 EILRVT 1 EILRV+ Sbjct: 66 EILRVS 71 >ref|XP_004953739.1| PREDICTED: KH domain-containing protein At5g56140-like [Setaria italica] Length = 286 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/66 (50%), Positives = 41/66 (62%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY + +R A+ EQEKYLAEL AE+ KL PF+ V+PHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIAGLRAPSAAVAEQEKYLAELLAERHKLGPFIPVIPHSVRLLNQ 65 Query: 18 EILRVT 1 EILRV+ Sbjct: 66 EILRVS 71 >gb|AFW63660.1| hypothetical protein ZEAMMB73_233372 [Zea mays] Length = 197 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY +RT A+ EQEKYL+EL AE+ KL PF+ V+PHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIHGLRTPSAAVAEQEKYLSELLAERHKLTPFIPVIPHSVRLLNQ 65 Query: 18 EILRVT 1 EI RV+ Sbjct: 66 EIFRVS 71 >gb|ACN35020.1| unknown [Zea mays] gi|413923729|gb|AFW63661.1| hypothetical protein ZEAMMB73_233372 [Zea mays] Length = 286 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY +RT A+ EQEKYL+EL AE+ KL PF+ V+PHS LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIHGLRTPSAAVAEQEKYLSELLAERHKLTPFIPVIPHSVRLLNQ 65 Query: 18 EILRVT 1 EI RV+ Sbjct: 66 EIFRVS 71 >gb|EAY87341.1| hypothetical protein OsI_08744 [Oryza sativa Indica Group] gi|215769394|dbj|BAH01623.1| unnamed protein product [Oryza sativa Japonica Group] Length = 286 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/66 (50%), Positives = 42/66 (63%) Frame = -3 Query: 198 YMAYXXXXXXXXXXXXXSVMRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQ 19 YMAY +R A A+ +QEKYLAEL AE+ KL+PF+ VLP+S LL+Q Sbjct: 6 YMAYSPSPSTTPHSPRIPGLRAASSAVADQEKYLAELLAERHKLSPFIPVLPNSVRLLNQ 65 Query: 18 EILRVT 1 EILRV+ Sbjct: 66 EILRVS 71 >ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g56140-like [Citrus sinensis] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/47 (61%), Positives = 40/47 (85%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ +QEKYL+EL AE+ KLNPF+ VLP++Y LL+QEI+RVT Sbjct: 27 LRSASSAILDQEKYLSELLAERHKLNPFLPVLPNAYRLLNQEIMRVT 73 >ref|XP_006452750.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] gi|557555976|gb|ESR65990.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] Length = 196 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/47 (61%), Positives = 40/47 (85%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ +QEKYL+EL AE+ KLNPF+ VLP++Y LL+QEI+RVT Sbjct: 27 LRSASSAILDQEKYLSELLAERHKLNPFLPVLPNTYRLLNQEIMRVT 73 >ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] gi|557555973|gb|ESR65987.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/47 (61%), Positives = 40/47 (85%) Frame = -3 Query: 141 MRTAGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 +R+A A+ +QEKYL+EL AE+ KLNPF+ VLP++Y LL+QEI+RVT Sbjct: 27 LRSASSAILDQEKYLSELLAERHKLNPFLPVLPNTYRLLNQEIMRVT 73 >ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis sativus] gi|449508337|ref|XP_004163285.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis sativus] Length = 296 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -3 Query: 132 AGGALGEQEKYLAELFAEQQKLNPFVQVLPHSYHLLSQEILRVT 1 + A+ EQEKYL+EL AE+QKL+PF+ VLP+SY LL+QEILRVT Sbjct: 34 SAAAILEQEKYLSELLAERQKLSPFMPVLPNSYRLLNQEILRVT 77